Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27030 108 / 4e-32 unknown protein AT5G40970 103 / 5e-31 Protein of unknown function (DUF 3339) (.1) AT3G48660 94 / 4e-27 Protein of unknown function (DUF 3339) (.1) AT5G63500 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) AT5G08391 88 / 5e-25 Protein of unknown function (DUF 3339) (.1) AT3G27027 81 / 3e-22 Protein of unknown function (DUF 3339) (.1) AT3G01950 81 / 3e-22 Protein of unknown function (DUF 3339) (.1) AT5G14110 80 / 7e-22 Protein of unknown function (DUF 3339) (.1) AT5G40980 73 / 4e-19 Protein of unknown function (DUF 3339) (.1) AT3G01940 57 / 2e-12 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032030 [exp] 136 / 5e-44 AT3G27030 106 / 2e-31 unknown protein Lus10032029 [exp] 136 / 4e-43 AT3G27027 106 / 4e-30 Protein of unknown function (DUF 3339) (.1) Lus10041551 [exp] 120 / 7e-38 AT3G27030 113 / 3e-34 unknown protein Lus10012542 [exp] 120 / 7e-38 AT3G27030 113 / 3e-34 unknown protein Lus10015769 [exp] 91 / 3e-26 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 90 / 8e-26 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 90 / 1e-25 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 90 / 1e-25 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 89 / 2e-25 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G064500 [exp] 121 / 2e-38 AT3G27030 111 / 2e-33 unknown protein Potri.001G328800 [exp] 117 / 1e-36 AT3G27030 79 / 2e-20 unknown protein Potri.015G098200 [exp] 102 / 4e-30 AT3G27030 107 / 7e-31 unknown protein Potri.003G170500 [exp] 94 / 1e-27 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 93 / 7e-27 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 92 / 9e-27 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 91 / 3e-26 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 89 / 3e-25 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 86 / 5e-24 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 82 / 8e-22 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10035199 pacid=23162539 polypeptide=Lus10035199 locus=Lus10035199.g ID=Lus10035199.BGIv1.0 annot-version=v1.0 ATGGCTGACTGGGGACCAATCTTGATAGGGGTAGTCCTGTTCATCCTGCTCACGCCAGGGCTCTTGTTTCAGTTCCCAGGGCACAGCAGACAGATCGAGT TTGGAAGCTTGAAGACCAATGGCAAATCCATCGCGGTTCACACTCTCATATTCTTCACTGTCTATGCTATTCTCATCTTAGCTGTTCGCGTCCACGTCTA CACTGGCTAA
AA sequence Show only first row Show all	>Lus10035199 pacid=23162539 polypeptide=Lus10035199 locus=Lus10035199.g ID=Lus10035199.BGIv1.0 annot-version=v1.0 MADWGPILIGVVLFILLTPGLLFQFPGHSRQIEFGSLKTNGKSIAVHTLIFFTVYAILILAVRVHVYTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27030			unknown protein		Lus10035199 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10010987 [exp]	6.1	0.9282
AT5G36930			Disease resistance protein (TI...		Lus10007852 [exp]	9.1	0.9256
AT4G16444			unknown protein		Lus10035992 [exp]	11.4	0.8258
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10009316 [exp]	11.5	0.9202
AT1G27180			disease resistance protein (TI...		Lus10007831 [exp]	11.7	0.9193
AT2G21370		XK1, XK-1	XYLULOSE KINASE 1, xylulose ki...		Lus10017967 [exp]	15.2	0.8962
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	16.0	0.9180
AT4G16400			unknown protein		Lus10038791 [exp]	17.1	0.9165
AT5G36930			Disease resistance protein (TI...		Lus10004726 [exp]	17.7	0.9176
AT5G04890		RTM2	RESTRICTED TEV MOVEMENT 2, HSP...		Lus10023624 [exp]	19.1	0.9088

Compare expression of checked genes

Lus10035199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.