Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40960 70 / 5e-18 Protein of unknown function (DUF 3339) (.1) AT3G48660 48 / 7e-09 Protein of unknown function (DUF 3339) (.1) AT5G63500 47 / 9e-09 Protein of unknown function (DUF 3339) (.1) AT5G08391 46 / 3e-08 Protein of unknown function (DUF 3339) (.1) AT3G27027 44 / 8e-08 Protein of unknown function (DUF 3339) (.1) AT5G40980 44 / 1e-07 Protein of unknown function (DUF 3339) (.1) AT3G27030 44 / 5e-07 unknown protein AT3G01950 37 / 8e-05 Protein of unknown function (DUF 3339) (.1) AT5G40970 36 / 0.0001 Protein of unknown function (DUF 3339) (.1) AT5G14110 36 / 0.0001 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032031 [exp] 92 / 1e-26 AT5G40960 81 / 2e-22 Protein of unknown function (DUF 3339) (.1) Lus10012541 [exp] 79 / 1e-21 AT5G40960 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Lus10041550 [exp] 79 / 1e-20 AT3G27030 122 / 8e-37 unknown protein Lus10011353 [exp] 48 / 3e-09 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 47 / 1e-08 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 47 / 1e-08 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 47 / 1e-08 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 46 / 2e-08 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 46 / 2e-08 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G328701 [exp] 78 / 2e-20 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064400 [exp] 76 / 4e-20 AT5G40960 49 / 1e-09 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 50 / 5e-10 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 49 / 9e-10 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 49 / 2e-09 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 48 / 3e-09 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 48 / 3e-09 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.017G064301 [exp] 47 / 5e-09 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G328800 [exp] 45 / 6e-08 AT3G27030 79 / 2e-20 unknown protein Potri.017G064500 [exp] 42 / 6e-07 AT3G27030 111 / 2e-33 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10035200 pacid=23162380 polypeptide=Lus10035200 locus=Lus10035200.g ID=Lus10035200.BGIv1.0 annot-version=v1.0 ATGAACGATTGGGGAGTACCACTGATAGCAGCAGCACTGTTTGGGTTTCTACAGCCAGGGTTGGTGGTTCAGATACCAGGGAAGGAGAGGCCAGTTGATT TCATGAACATGAAGACAAGTTTGGCATCCATGTTTGCTCACTTGGTCATCTTTGCTCTCCTCCTTATCTTGTTCCTCGTCATCCTCGACGCTCACCTCTA TGTCTAA
AA sequence Show only first row Show all	>Lus10035200 pacid=23162380 polypeptide=Lus10035200 locus=Lus10035200.g ID=Lus10035200.BGIv1.0 annot-version=v1.0 MNDWGVPLIAAALFGFLQPGLVVQIPGKERPVDFMNMKTSLASMFAHLVIFALLLILFLVILDAHLYV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40960			Protein of unknown function (D...		Lus10035200 [exp]	0	1
AT2G01420		PIN4, ATPIN4	ARABIDOPSIS PIN-FORMED 4, Auxi...		Lus10012680 [exp]	3.5	0.8304
AT1G25250	C2H2ZnF	ATIDD16	indeterminate(ID)-domain 16 (....		Lus10031314 [exp]	4.5	0.8110
AT2G01940	C2H2ZnF	SGR5, ATIDD15	SHOOT GRAVITROPISM 5, ARABIDOP...		Lus10031882 [exp]	5.7	0.8048
AT3G57200			unknown protein		Lus10018036 [exp]	6.0	0.7624
AT2G01420		PIN4, ATPIN4	ARABIDOPSIS PIN-FORMED 4, Auxi...		Lus10020830 [exp]	10.2	0.7720
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Lus10039488 [exp]	10.2	0.7111
AT3G11110			RING/U-box superfamily protein...		Lus10040942 [exp]	10.6	0.7308
AT1G11120			unknown protein		Lus10018462 [exp]	14.0	0.7071
AT5G08580			Calcium-binding EF hand family...		Lus10010165 [exp]	16.0	0.7321
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10042922 [exp]	16.5	0.7288

Compare expression of checked genes

Lus10035200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.