Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08391 104 / 1e-31 Protein of unknown function (DUF 3339) (.1) AT3G27030 102 / 8e-30 unknown protein AT3G48660 100 / 2e-29 Protein of unknown function (DUF 3339) (.1) AT5G63500 95 / 8e-28 Protein of unknown function (DUF 3339) (.1) AT3G27027 83 / 4e-23 Protein of unknown function (DUF 3339) (.1) AT5G14110 79 / 2e-21 Protein of unknown function (DUF 3339) (.1) AT3G01950 77 / 7e-21 Protein of unknown function (DUF 3339) (.1) AT5G40980 76 / 2e-20 Protein of unknown function (DUF 3339) (.1) AT5G40970 69 / 2e-17 Protein of unknown function (DUF 3339) (.1) AT5G50660 60 / 9e-14 Protein of unknown function (DUF 3339) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032032 [exp] 140 / 1e-45 AT5G08391 104 / 2e-31 Protein of unknown function (DUF 3339) (.1) Lus10015770 [exp] 104 / 2e-31 AT5G08391 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037035 [exp] 104 / 2e-31 AT5G08391 111 / 2e-34 Protein of unknown function (DUF 3339) (.1) Lus10011353 [exp] 102 / 1e-30 AT3G48660 122 / 1e-38 Protein of unknown function (DUF 3339) (.1) Lus10003120 [exp] 100 / 5e-30 AT3G48660 121 / 5e-38 Protein of unknown function (DUF 3339) (.1) Lus10035198 [exp] 94 / 2e-27 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) Lus10032028 [exp] 94 / 2e-27 AT3G48660 99 / 5e-29 Protein of unknown function (DUF 3339) (.1) Lus10015769 [exp] 94 / 4e-27 AT3G48660 112 / 1e-34 Protein of unknown function (DUF 3339) (.1) Lus10037036 [exp] 92 / 1e-26 AT3G48660 112 / 3e-34 Protein of unknown function (DUF 3339) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G064301 [exp] 117 / 1e-36 AT5G08391 108 / 5e-33 Protein of unknown function (DUF 3339) (.1) Potri.001G329000 [exp] 117 / 1e-36 AT5G08391 113 / 5e-35 Protein of unknown function (DUF 3339) (.1) Potri.001G057900 [exp] 106 / 3e-32 AT5G08391 113 / 6e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170500 [exp] 105 / 6e-32 AT5G08391 112 / 9e-35 Protein of unknown function (DUF 3339) (.1) Potri.003G170400 [exp] 97 / 1e-28 AT3G48660 89 / 3e-25 Protein of unknown function (DUF 3339) (.1) Potri.015G098300 [exp] 92 / 3e-26 AT3G48660 107 / 3e-32 Protein of unknown function (DUF 3339) (.1) Potri.017G064500 [exp] 86 / 4e-24 AT3G27030 111 / 2e-33 unknown protein Potri.001G328800 [exp] 82 / 8e-23 AT3G27030 79 / 2e-20 unknown protein Potri.001G058001 [exp] 83 / 9e-23 AT3G48660 74 / 9e-19 Protein of unknown function (DUF 3339) (.1) Potri.001G328701 [exp] 84 / 1e-22 AT3G27027 115 / 7e-35 Protein of unknown function (DUF 3339) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11820 [flax] [poplar] DUF3339 Protein of unknown function (DUF3339)
Representative CDS sequence Show only first row Show all	>Lus10035201 pacid=23162518 polypeptide=Lus10035201 locus=Lus10035201.g ID=Lus10035201.BGIv1.0 annot-version=v1.0 ATGATGGTGGACTGGGGGCCAGTGTTCATTGCAGTGATGCTGTTCATACTGCTAACACCAGGGCTGCTCATCCAGGTACCTGGGAACGGGCGGTACGTCG AGTTCAGCAACTTCCAGACGAGTGGAGTTTCGGTTCTGGTTCATTCAATCATCTACTTCTCTTTGATGTGCATCTTCTTGCTTGCTATTGGTCTCCATAT GTATGTGGGTTCATAA
AA sequence Show only first row Show all	>Lus10035201 pacid=23162518 polypeptide=Lus10035201 locus=Lus10035201.g ID=Lus10035201.BGIv1.0 annot-version=v1.0 MMVDWGPVFIAVMLFILLTPGLLIQVPGNGRYVEFSNFQTSGVSVLVHSIIYFSLMCIFLLAIGLHMYVGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08391			Protein of unknown function (D...		Lus10035201 [exp]	0	1
AT2G42820		HVA22F	HVA22-like protein F (.1)		Lus10031386 [exp]	4.8	0.9176
AT2G42820		HVA22F	HVA22-like protein F (.1)		Lus10010944 [exp]	7.6	0.9029
AT1G13920			Remorin family protein (.1)		Lus10037111 [exp]	10.7	0.8903
AT3G18260			Reticulon family protein (.1)		Lus10032451 [exp]	16.7	0.8874
AT1G76770			HSP20-like chaperones superfam...		Lus10018882 [exp]	24.6	0.8432
AT2G20362			unknown protein		Lus10022860 [exp]	24.9	0.8374
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10009316 [exp]	26.8	0.8577
AT5G47760		ATPK5, ATPGLP2	2-phosphoglycolate phosphatase...		Lus10038761 [exp]	27.5	0.7819
AT5G59030		COPT1	copper transporter 1 (.1)		Lus10017204 [exp]	30.0	0.8320
AT1G76770			HSP20-like chaperones superfam...		Lus10028577 [exp]	31.1	0.8393

Compare expression of checked genes

Lus10035201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.