Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27310 184 / 1e-61 NTF2A nuclear transport factor 2A (.1) AT1G27970 177 / 7e-59 NTF2B nuclear transport factor 2B (.1.2) AT1G11570 122 / 4e-37 NTL NTF2-like (.1.2) AT5G60980 39 / 0.0005 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT5G48650 38 / 0.001 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032033 [exp] 206 / 2e-70 AT1G27970 227 / 1e-78 nuclear transport factor 2B (.1.2) Lus10037033 [exp] 191 / 2e-64 AT1G27970 231 / 5e-80 nuclear transport factor 2B (.1.2) Lus10015772 [exp] 189 / 2e-63 AT1G27310 188 / 9e-63 nuclear transport factor 2A (.1) Lus10020061 [exp] 116 / 1e-34 AT1G11570 171 / 3e-56 NTF2-like (.1.2) Lus10006762 [exp] 115 / 2e-34 AT1G11570 130 / 2e-40 NTF2-like (.1.2) Lus10036918 [exp] 39 / 0.0003 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10037066 [exp] 38 / 0.001 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G057500 [exp] 182 / 9e-61 AT1G27970 228 / 4e-79 nuclear transport factor 2B (.1.2) Potri.003G170800 [exp] 179 / 7e-60 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2) Potri.011G025500 [exp] 124 / 1e-37 AT1G11570 171 / 5e-56 NTF2-like (.1.2) Potri.017G094600 [exp] 40 / 0.0001 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G157800 [exp] 39 / 0.0005 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0051 [flax] [poplar] NTF2 PF02136 [flax] [poplar] NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence Show only first row Show all	>Lus10035202 pacid=23162545 polypeptide=Lus10035202 locus=Lus10035202.g ID=Lus10035202.BGIv1.0 annot-version=v1.0 ATGAATCCAGATGATGTGGCCAAGGCGTTCGTCGATCACTACTACTCCACCTTCGACAGTAACCGAGCGGGACTCATCGGATTGTATCAAGACGGATCCA TGCTGACGTTCGAGGGCCAGCAGATCCAGGGCGCTCAGAACATCGTCGGCAAGCTCACCAGCCTTCCTTTCGAGCAGTGCAAGCACTCCGTCACCACCGT CGATTGCCAGCCGTCGGGTCCCGCCGGTGGCATGCTCGTGTTTGTTAGCGGTAATCTTCAATTGGCCGGCGAGCAACACCCTCTCAAGTTCAGTCAGAAT GTTGAGTTGATCTTGAATCCAGATATAGGGTTTGATCACACTATTGAAATCGTATAG
AA sequence Show only first row Show all	>Lus10035202 pacid=23162545 polypeptide=Lus10035202 locus=Lus10035202.g ID=Lus10035202.BGIv1.0 annot-version=v1.0 MNPDDVAKAFVDHYYSTFDSNRAGLIGLYQDGSMLTFEGQQIQGAQNIVGKLTSLPFEQCKHSVTTVDCQPSGPAGGMLVFVSGNLQLAGEQHPLKFSQN VELILNPDIGFDHTIEIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27310		NTF2A	nuclear transport factor 2A (....		Lus10035202 [exp]	0	1
AT1G15710			prephenate dehydrogenase famil...		Lus10023121 [exp]	1.0	0.9350
AT2G17265		DMR1, HSK	DOWNY MILDEW RESISTANT 1, homo...		Lus10022990 [exp]	2.0	0.9096
AT1G27970		NTF2B	nuclear transport factor 2B (....		Lus10032033 [exp]	2.8	0.8903
AT4G12340			copper ion binding (.1)		Lus10024588 [exp]	3.0	0.8974
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Lus10026814 [exp]	3.7	0.8658
AT4G28730		GrxC5	glutaredoxin C5, Glutaredoxin ...		Lus10011915 [exp]	3.9	0.8878
AT1G54990		RGR1, AXR4	REDUCED ROOT GRAVITROPISM 1, R...		Lus10004478 [exp]	4.2	0.8531
AT1G51370			F-box/RNI-like/FBD-like domain...		Lus10027020 [exp]	4.5	0.8804
AT2G34510			Protein of unknown function, D...		Lus10023314 [exp]	5.1	0.8672
AT4G25680			PPPDE putative thiol peptidase...		Lus10039275 [exp]	5.7	0.8799

Compare expression of checked genes

Lus10035202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.