Lus10035204 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G67400 244 / 5e-80 RHS19 root hair specific 19 (.1)
AT4G37530 240 / 4e-79 Peroxidase superfamily protein (.1.2)
AT5G14130 238 / 1e-77 Peroxidase superfamily protein (.1)
AT4G37520 233 / 2e-75 Peroxidase superfamily protein (.1.2)
AT3G49960 224 / 3e-72 Peroxidase superfamily protein (.1)
AT2G18980 213 / 6e-68 Peroxidase superfamily protein (.1)
AT4G30170 212 / 2e-67 Peroxidase family protein (.1)
AT5G47000 187 / 2e-57 Peroxidase superfamily protein (.1)
AT4G17690 184 / 1e-56 Peroxidase superfamily protein (.1)
AT1G24110 168 / 2e-50 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032035 367 / 2e-128 AT5G67400 394 / 3e-138 root hair specific 19 (.1)
Lus10012540 318 / 7e-109 AT5G14130 384 / 5e-134 Peroxidase superfamily protein (.1)
Lus10011079 236 / 2e-76 AT4G37530 479 / 2e-171 Peroxidase superfamily protein (.1.2)
Lus10001442 225 / 3e-72 AT4G30170 475 / 7e-170 Peroxidase family protein (.1)
Lus10001622 170 / 4e-51 AT2G18980 320 / 4e-109 Peroxidase superfamily protein (.1)
Lus10039445 166 / 2e-49 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10005278 169 / 9e-49 AT2G34060 441 / 3e-152 Peroxidase superfamily protein (.1)
Lus10042144 164 / 1e-48 AT1G24110 390 / 2e-136 Peroxidase superfamily protein (.1)
Lus10004234 164 / 2e-48 AT1G24110 391 / 1e-136 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G064100 300 / 4e-102 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.001G329200 288 / 2e-97 AT4G37530 392 / 4e-137 Peroxidase superfamily protein (.1.2)
Potri.007G053400 236 / 6e-77 AT5G67400 471 / 4e-168 root hair specific 19 (.1)
Potri.018G089900 228 / 1e-73 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.007G074700 202 / 1e-63 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
Potri.012G076500 177 / 5e-54 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1)
Potri.001G351000 176 / 2e-53 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.010G036100 172 / 4e-52 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.012G042800 166 / 1e-49 AT1G05260 336 / 2e-115 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Potri.004G052100 166 / 3e-49 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10035204 pacid=23162416 polypeptide=Lus10035204 locus=Lus10035204.g ID=Lus10035204.BGIv1.0 annot-version=v1.0
ATGGGTTACTTCAGTTCCTCTACGTCGGCGGCCATGATTATGATCATCGTTGCGACTACCATCGCTGGGGGCGGCGGCGTGTCAGGCCAAGGACTGAGGG
AGAATTTCTACGCGGGAAGTTGTCCAATGGTGGAGCCTATAGTACAGCAAGTGGTGGCGGCCAAAGCCGGCCGGCAGTTCCCCACCCTACCAGCCACTCT
CCGCCTCTTCTTCCACGACTGCTTCGTTACTGGCTGCGATGCCTCAGTAATGGTGGCATCACCGAACGGAGACGCAGAGAAAGATGCTCTGGACAATCTA
TCCCTGGCCGGCGACGGATTCGACGCCGTATCAAGAGCTAAAACAGCTGTAGAAGCTATATGCCCTGGAGTCGTTTCTTGTGCAGATATCATCGCCATCG
CAGCTCGTGATGTTGTCGCCTTGGCAGGAGGCCCGACGTTCGCGGTGGAATTAGGGCGGAGGGACGGCATGATATCCAGCGTATCCCTCGTCGCCGGAAA
CTTGCCGGAGCCAAACATGACCCTACCCGAACTCAACGCAATCTTCGCCAAACACAACCTCACCCAATTCGACATGATCGCGCTTTCGGGAGTTCACACG
CTCGGCTTCTCCCACTGCAATCGATTCTTCAATCGCATCTACTCTTCCACAGTCGACCCTTCCCTGAACTCCACCTACGCCCAGCAGCTGATGACGGCCT
GCCCGAGGAACGTGGATCCCAGCATCCGCAATCGACATGGATCCGACGACTCCGAGGGCATTCGACAACGTGTATTACCAGAATCTGGTCGAGGGGAAGG
GTATGTTTAG
AA sequence
>Lus10035204 pacid=23162416 polypeptide=Lus10035204 locus=Lus10035204.g ID=Lus10035204.BGIv1.0 annot-version=v1.0
MGYFSSSTSAAMIMIIVATTIAGGGGVSGQGLRENFYAGSCPMVEPIVQQVVAAKAGRQFPTLPATLRLFFHDCFVTGCDASVMVASPNGDAEKDALDNL
SLAGDGFDAVSRAKTAVEAICPGVVSCADIIAIAARDVVALAGGPTFAVELGRRDGMISSVSLVAGNLPEPNMTLPELNAIFAKHNLTQFDMIALSGVHT
LGFSHCNRFFNRIYSSTVDPSLNSTYAQQLMTACPRNVDPSIRNRHGSDDSEGIRQRVLPESGRGEGYV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G67400 RHS19 root hair specific 19 (.1) Lus10035204 0 1
AT4G32650 AtLKT1, KAT3, A... A. thaliana low-K+-tolerant 1,... Lus10037904 1.0 0.9742
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10000611 2.8 0.9667
AT5G39820 NAC ANAC094 NAC domain containing protein ... Lus10007263 7.5 0.9614
AT4G03965 RING/U-box superfamily protein... Lus10015152 8.5 0.9601
AT3G01650 RGLG1 RING domain ligase1 (.1) Lus10006463 8.9 0.9612
AT5G65790 MYB AtMYB68 myb domain protein 68 (.1) Lus10028248 10.2 0.9610
AT3G51440 Calcium-dependent phosphotries... Lus10041827 11.6 0.9552
AT5G18350 Disease resistance protein (TI... Lus10018024 12.0 0.9387
AT2G36950 Heavy metal transport/detoxifi... Lus10022617 14.4 0.9552
AT1G47128 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A,... Lus10002827 14.4 0.9499

Lus10035204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.