Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50460 99 / 2e-29 secE/sec61-gamma protein transport protein (.1) AT4G24920 99 / 2e-29 secE/sec61-gamma protein transport protein (.1) AT3G48570 95 / 9e-28 secE/sec61-gamma protein transport protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041552 [exp] 110 / 1e-33 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1) Lus10012539 [exp] 110 / 1e-33 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1) Lus10019065 [exp] 60 / 1e-13 AT4G31985 100 / 2e-29 Ribosomal protein L39 family protein (.1) Lus10032037 [exp] 0 / 1 AT3G48560 96 / 3e-23 TRIAZOLOPYRIMIDINE RESISTANT 5, IMIDAZOLE RESISTANT 1, ACETOLACTATE SYNTHASE, ACETOHYDROXY ACID SYNTHASE, chlorsulfuron/imidazolinone resistant 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G329400 [exp] 102 / 7e-31 AT5G50460 99 / 2e-29 secE/sec61-gamma protein transport protein (.1) Potri.012G098400 [exp] 99 / 2e-29 AT5G50460 104 / 2e-31 secE/sec61-gamma protein transport protein (.1) Potri.015G097300 [exp] 98 / 5e-29 AT5G50460 103 / 3e-31 secE/sec61-gamma protein transport protein (.1) Potri.017G064032 [exp] 78 / 4e-21 AT5G50460 101 / 4e-30 secE/sec61-gamma protein transport protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00584 [flax] [poplar] SecE SecE/Sec61-gamma subunits of protein translocation complex
Representative CDS sequence Show only first row Show all	>Lus10035206 pacid=23162370 polypeptide=Lus10035206 locus=Lus10035206.g ID=Lus10035206.BGIv1.0 annot-version=v1.0 ATGGACGCCATTGACAACGTGTTCGATCCGCTCAGGGAATTCGCCAAGGACAGTGTAAGACTCGTGAAGCGTTGCCACAAGCCAGATCGGAAAGAGTTTT CGAAGGTGGCTGTGCGTACGGCGATAGGTTTCGTGGTGATGGGATTCGTAGGATTCTTCGTCAAGCTCATCTTCATCCCCATCAATAACATCATTGTAGG ATCTGGTTAG
AA sequence Show only first row Show all	>Lus10035206 pacid=23162370 polypeptide=Lus10035206 locus=Lus10035206.g ID=Lus10035206.BGIv1.0 annot-version=v1.0 MDAIDNVFDPLREFAKDSVRLVKRCHKPDRKEFSKVAVRTAIGFVVMGFVGFFVKLIFIPINNIIVGSG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50460			secE/sec61-gamma protein trans...		Lus10035206 [exp]	0	1
AT1G15370			SNARE-like superfamily protein...		Lus10002016 [exp]	2.4	0.8386
AT3G24100			Uncharacterised protein family...		Lus10007122 [exp]	4.6	0.7765
AT3G46010		ATADF1, ADF1	actin depolymerizing factor 1 ...		Lus10025319 [exp]	4.9	0.8035
AT4G14380			unknown protein		Lus10021182 [exp]	8.2	0.8103
AT5G41330			BTB/POZ domain with WD40/YVTN ...		Lus10017502 [exp]	9.2	0.7568
AT1G75950		UIP1, SKP1A, AT...	UFO INTERACTING PROTEIN 1, ARA...		Lus10013575 [exp]	12.0	0.7842
					Lus10017454 [exp]	14.7	0.7689
AT2G23090			Uncharacterised protein family...		Lus10014734 [exp]	17.0	0.7497
AT1G12240		ATBETAFRUCT4, V...	VACUOLAR INVERTASE, Glycosyl h...		Lus10028922 [exp]	17.8	0.7928
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10020647 [exp]	18.3	0.7691

Compare expression of checked genes

Lus10035206 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.