Lus10035211 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27080 194 / 2e-62 TOM20-3 translocase of outer membrane 20 kDa subunit 3 (.1)
AT1G27390 185 / 9e-59 TOM20-2 translocase outer membrane 20-2 (.1)
AT5G40930 167 / 4e-52 TOM20-4 translocase of outer membrane 20-4 (.1)
AT3G27070 159 / 9e-49 TOM20-1 translocase outer membrane 20-1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032045 413 / 2e-148 AT3G27080 211 / 2e-69 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10012532 268 / 1e-84 AT3G01910 616 / 0.0 sulfite oxidase (.1.2.3)
Lus10011363 152 / 7e-46 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10006419 144 / 7e-43 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10041558 112 / 6e-31 AT3G27080 83 / 5e-20 translocase of outer membrane 20 kDa subunit 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G330200 243 / 7e-82 AT1G27390 215 / 3e-71 translocase outer membrane 20-2 (.1)
Potri.001G054900 219 / 2e-72 AT1G27390 230 / 4e-77 translocase outer membrane 20-2 (.1)
Potri.003G173400 207 / 1e-67 AT3G27080 208 / 2e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20
Representative CDS sequence
>Lus10035211 pacid=23162540 polypeptide=Lus10035211 locus=Lus10035211.g ID=Lus10035211.BGIv1.0 annot-version=v1.0
ATGGACATGTCGAGCGATTTGGACAGGATGCTCTTCTTCGAGCACGCTCGTAAAACAGCTGAGGCTACATATGCTACCAACCCGCTGGATGCCGAGTTCT
GGAGTTATTCATTTGTTACTGCGGTGTCTAGCTTTCTAGTGCTTGAATTTGAACTTTATGGTGATTTCCGGGGTCAGAATTTGACGAGATGGGGTGGGTC
TCTGATGGAGCTGGCTCAGTTTCAGAGTGTTCCAGATGCGAAGAAGATGATTCTAGATGGAATTTCCAAGTTAGACGAGGCATTGTCGATAAATCCCATG
AAGCATGATGCTCTCTGGTGTCTGGGAAATGCTAATACATCTTATGCATTCTTAACCCCCAGCGAGGAGGAAGCAGATGCATATTTCAAGAAAGCAACTG
TCTACTTTCAACAAGCTGTTGATGAGGATCCAAGCAATGAGTTGTATGCCAAGTCGCTAGAAGTGGCTGCTAAGGCACCAGAATTGCACTCAGAGATTCA
TAAGCATGGTATGATGGACCAACAGGCATTAGGGGGTGGACCGGCGCCTGGACCTTCTGCCCCAATGGCCAAAAAGCCTGCAAAGAAAGAGAAGATCAGT
GATACCACGTACGACGCATTAGGATGGGTTATTCTTGCGGTAGGGATTTTTGCAATAGTGGGAGTGGGATTCGCAAAATCCCAGATGCCTCCAGTTCCTC
CGCCTGCCCGGTAA
AA sequence
>Lus10035211 pacid=23162540 polypeptide=Lus10035211 locus=Lus10035211.g ID=Lus10035211.BGIv1.0 annot-version=v1.0
MDMSSDLDRMLFFEHARKTAEATYATNPLDAEFWSYSFVTAVSSFLVLEFELYGDFRGQNLTRWGGSLMELAQFQSVPDAKKMILDGISKLDEALSINPM
KHDALWCLGNANTSYAFLTPSEEEADAYFKKATVYFQQAVDEDPSNELYAKSLEVAAKAPELHSEIHKHGMMDQQALGGGPAPGPSAPMAKKPAKKEKIS
DTTYDALGWVILAVGIFAIVGVGFAKSQMPPVPPPAR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10035211 0 1
AT4G29830 VIP3 vernalization independence 3, ... Lus10017159 1.7 0.9686
AT3G15000 cobalt ion binding (.1) Lus10043130 2.6 0.9585
AT3G25150 Nuclear transport factor 2 (NT... Lus10022765 2.8 0.9584
AT3G49910 Translation protein SH3-like f... Lus10018139 4.2 0.9638
AT3G04770 RPSAB 40s ribosomal protein SA B (.1... Lus10013183 5.5 0.9668
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10032045 6.1 0.9353
AT1G09620 ATP binding;leucine-tRNA ligas... Lus10032321 7.2 0.9516
AT3G04770 RPSAB 40s ribosomal protein SA B (.1... Lus10037445 8.1 0.9588
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10000946 8.5 0.9616
AT5G43970 ATTOM22-V, TOM2... TRANSLOCASE OUTER MITOCHONDRIA... Lus10024950 9.2 0.9409

Lus10035211 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.