Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14180 62 / 3e-13 MPL1 Myzus persicae-induced lipase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022349 [exp] 59 / 3e-12 AT5G14180 527 / 0.0 Myzus persicae-induced lipase 1 (.1) Lus10041571 [exp] 58 / 8e-12 AT5G14180 525 / 0.0 Myzus persicae-induced lipase 1 (.1) Lus10038401 [exp] 39 / 3e-05 AT5G14180 383 / 4e-131 Myzus persicae-induced lipase 1 (.1) Lus10038378 [exp] 39 / 3e-05 AT5G14180 377 / 2e-129 Myzus persicae-induced lipase 1 (.1) Lus10026167 [exp] 38 / 0.0001 AT5G14180 99 / 6e-24 Myzus persicae-induced lipase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G332300 [exp] 61 / 7e-13 AT5G14180 533 / 0.0 Myzus persicae-induced lipase 1 (.1) Potri.017G069700 [exp] 48 / 2e-08 AT5G14180 374 / 4e-128 Myzus persicae-induced lipase 1 (.1) Potri.014G159800 [exp] 47 / 4e-08 AT5G14180 422 / 3e-146 Myzus persicae-induced lipase 1 (.1) Potri.014G159900 [exp] 46 / 2e-07 AT5G14180 421 / 9e-146 Myzus persicae-induced lipase 1 (.1) Potri.014G159700 [exp] 42 / 5e-06 AT5G14180 441 / 5e-154 Myzus persicae-induced lipase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035218 pacid=23162436 polypeptide=Lus10035218 locus=Lus10035218.g ID=Lus10035218.BGIv1.0 annot-version=v1.0 ATGGCGAGCAAGATTCAAATCGTCTACGTCGAAGATGTGATGCATTTGCTTGATCACTTCAAGGTTCATGACCCGAATAAGATCCAAAAGCAAGTTGTGA AACAGTATGCTCACGTAGATTTCATCATGGGACTCAATGCCAAGGACATTATCTACAATCAAGTTTGCAATGGCACAAATTAA
AA sequence Show only first row Show all	>Lus10035218 pacid=23162436 polypeptide=Lus10035218 locus=Lus10035218.g ID=Lus10035218.BGIv1.0 annot-version=v1.0 MASKIQIVYVEDVMHLLDHFKVHDPNKIQKQVVKQYAHVDFIMGLNAKDIIYNQVCNGTN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10035218 [exp]	0	1
					Lus10032779 [exp]	1.4	0.7485
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10022912 [exp]	2.4	0.7452
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10023564 [exp]	4.0	0.7228
AT5G01750			Protein of unknown function (D...		Lus10014154 [exp]	4.6	0.7307
AT4G21020			Late embryogenesis abundant pr...		Lus10015427 [exp]	7.9	0.6774
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10012001 [exp]	13.0	0.6819
AT3G46290		HERK1	hercules receptor kinase 1 (.1...		Lus10023325 [exp]	13.6	0.6776
AT4G22200		AKT3, AKT2/3	potassium transport 2/3 (.1)		Lus10003644 [exp]	17.2	0.6597
AT3G08720		ATPK2, ATPK19, ...	ARABIDOPSIS THALIANA SERINE/TH...		Lus10010054 [exp]	17.5	0.6568
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10037137 [exp]	19.6	0.6386

Compare expression of checked genes

Lus10035218 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.