Lus10035224 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G01820 233 / 1e-76 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G37250 155 / 5e-46 ADK, ATPADK1 adenosine kinase (.1)
AT2G39270 139 / 2e-39 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G50370 72 / 9e-15 Adenylate kinase family protein (.1)
AT4G25280 70 / 6e-14 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G63400 69 / 1e-13 ADK1 adenylate kinase 1 (.1.2)
AT3G60180 57 / 1e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT5G35170 57 / 5e-09 adenylate kinase family protein (.1.2)
AT5G26667 55 / 5e-09 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT5G47840 47 / 5e-06 AMK2 adenosine monophosphate kinase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032057 439 / 2e-157 AT3G01820 244 / 5e-81 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10022342 327 / 3e-113 AT3G01820 255 / 4e-85 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10001984 156 / 4e-46 AT2G37250 391 / 4e-138 adenosine kinase (.1)
Lus10030296 156 / 4e-46 AT2G37250 395 / 1e-139 adenosine kinase (.1)
Lus10040358 155 / 1e-45 AT2G37250 405 / 1e-143 adenosine kinase (.1)
Lus10023476 154 / 3e-45 AT2G37250 407 / 2e-144 adenosine kinase (.1)
Lus10031714 67 / 3e-12 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016757 64 / 6e-12 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2)
Lus10022453 64 / 1e-11 AT5G63400 411 / 2e-147 adenylate kinase 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G333100 276 / 2e-93 AT3G01820 249 / 8e-83 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.015G093200 239 / 6e-79 AT3G01820 227 / 3e-74 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.010G215300 159 / 2e-47 AT2G37250 382 / 2e-134 adenosine kinase (.1)
Potri.008G046100 153 / 5e-45 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Potri.012G095700 106 / 5e-29 AT3G01820 90 / 8e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G095300 68 / 3e-13 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2)
Potri.015G129000 64 / 9e-12 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.015G092800 62 / 3e-11 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2)
Potri.018G113400 56 / 7e-09 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2)
Potri.019G078200 55 / 1e-08 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00406 ADK Adenylate kinase
Representative CDS sequence
>Lus10035224 pacid=23162479 polypeptide=Lus10035224 locus=Lus10035224.g ID=Lus10035224.BGIv1.0 annot-version=v1.0
ATGGGCGTAATTAGTCGAGCGGGGTTGGCTACAGCTCCCTCCATCCTCCGTCGCCTGGGGCTCCTCTCTGGAACCCGAACTTATGGATCGGCGGCAGCAG
TCCAGTACCATTATTACGACGAAGAGGAGGAGGAGGAGACGCCGGAACCTTCTCCCTTGCGTCGGAGCCTTGCGACGGCTGTGTCCGGGTCGACGTTGGA
GAGAGGAGTGCAGTGGGTGTTGATCGGGGATCCCGGAGCTAAGAAGCATATGTACGCCGAGAGACTCTCGAAGGTTCTACAAGTTCCTCACATTTCTATG
GGGAATCTCCTTCGACAGGAGCTCAATCCTCGTTCTTCTCTTTACAAACATATATCAAATGCTGTGAACGAAGGGAAGCTTGTGCACGAGGAGGTAATCT
TTGGGTTGCTTTCGGAGAGGCTTGAAGATGGATACTCTAAAGGGGAAAGCGGCTTCGTTTTGGATGGCATTCCCAGAACTAGATTGCAAGCTGAGATCCT
TGATCAAATTGCTGACATTGATCTAGTGGTGAACTTCAAAACTTCCGAGCAGCGGCTGGTGAAAAGCAATTATGTTGGCATACGACATTCTGCAACTGCT
AGCGGAATAAGCAATTCTTGGGATGAAAAGTCCCGCCTACATGCAGAAGAGGGCAAGGCATTGGAAGATTACTACAGAAAACAGAGAAAGCTTATCAATT
TTCAAGTCGCAGGTGGACCAGGAGAGACCTGGCAGAGCTTGTTGGCTACTTTACATCTCAAGCAAGCCAATGCCATTCTTCTCTCTTCAACGAAACTCGC
TGTTTGA
AA sequence
>Lus10035224 pacid=23162479 polypeptide=Lus10035224 locus=Lus10035224.g ID=Lus10035224.BGIv1.0 annot-version=v1.0
MGVISRAGLATAPSILRRLGLLSGTRTYGSAAAVQYHYYDEEEEEETPEPSPLRRSLATAVSGSTLERGVQWVLIGDPGAKKHMYAERLSKVLQVPHISM
GNLLRQELNPRSSLYKHISNAVNEGKLVHEEVIFGLLSERLEDGYSKGESGFVLDGIPRTRLQAEILDQIADIDLVVNFKTSEQRLVKSNYVGIRHSATA
SGISNSWDEKSRLHAEEGKALEDYYRKQRKLINFQVAGGPGETWQSLLATLHLKQANAILLSSTKLAV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G01820 P-loop containing nucleoside t... Lus10035224 0 1
AT3G01820 P-loop containing nucleoside t... Lus10032057 1.0 0.8528
AT5G60790 ABCF1, ATGCN1 ARABIDOPSIS THALIANA GENERAL C... Lus10038681 2.0 0.8516
AT5G49400 zinc knuckle (CCHC-type) famil... Lus10037744 6.0 0.8263
AT4G27460 Cystathionine beta-synthase (C... Lus10018183 6.6 0.7153
AT5G09450 Tetratricopeptide repeat (TPR)... Lus10034221 9.5 0.7513
AT4G31010 RNA-binding CRS1 / YhbY (CRM) ... Lus10041383 9.8 0.7405
AT5G19180 ECR1 E1 C-terminal related 1 (.1) Lus10010507 9.8 0.7555
AT4G27680 P-loop containing nucleoside t... Lus10022361 12.6 0.7511
AT5G49400 zinc knuckle (CCHC-type) famil... Lus10037745 13.0 0.8154
AT3G22980 Ribosomal protein S5/Elongatio... Lus10004749 18.8 0.7929

Lus10035224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.