Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27470 83 / 2e-19 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT1G13000 80 / 1e-18 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT3G26440 56 / 5e-10 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3), Protein of unknown function (DUF707) (.4) AT2G28310 55 / 8e-10 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) AT1G67850 55 / 1e-09 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) AT1G08040 39 / 0.0006 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032090 [exp] 151 / 4e-45 AT3G27470 564 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10022287 [exp] 129 / 2e-36 AT3G27470 548 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10003659 [exp] 125 / 2e-35 AT3G27470 563 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10011414 [exp] 61 / 8e-12 AT1G67850 611 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10006472 [exp] 56 / 5e-10 AT1G67850 598 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Lus10041316 [exp] 52 / 9e-09 AT2G28310 590 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) Lus10037396 [exp] 52 / 1e-08 AT5G60700 1181 / 0.0 glycosyltransferase family protein 2 (.1) Lus10016095 [exp] 43 / 2e-05 AT2G28310 604 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3) Lus10021463 [exp] 42 / 3e-05 AT2G28310 594 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2), Protein of unknown function (DUF707) (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G065200 [exp] 112 / 3e-30 AT3G27470 605 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.008G185600 [exp] 69 / 9e-15 AT1G67850 610 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2) Potri.010G047200 [exp] 66 / 2e-13 AT1G67850 581 / 0.0 Protein of unknown function (DUF707) (.1), Protein of unknown function (DUF707) (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035228 pacid=23162526 polypeptide=Lus10035228 locus=Lus10035228.g ID=Lus10035228.BGIv1.0 annot-version=v1.0 ATGTCATTACCGTACAACCCTTTCTATTTCCCTCTCCGGCTAACGGAATCCTACGTCGCCGCCGGAAAGATTCTTTATTTCTTGTACGGATGTCGTAAAG GGGAAGACCCGGCAGAAACAGAGCCATCTACGGCAGAATCAAAGGCTAATGAAATGATGAAGCTTTTCCTGACAACTTTGCTTGGCATTGTCTTTGGCTT CTTCTTGGCTATATCCATGCCCACACTCTCCCTGTCAAAGATGAATCTTCCATCTGGTTTGTTCCCTTCCTTTGACATCACTTATATGGAGGACAAGTAC TCTGGTCTATCGCCACAAGCGCTGATCAACGCTTTGTCCTCCCTCGGGGGTCGTAGCGTGAACTCTTTGTTATTTCACAGATAA
AA sequence Show only first row Show all	>Lus10035228 pacid=23162526 polypeptide=Lus10035228 locus=Lus10035228.g ID=Lus10035228.BGIv1.0 annot-version=v1.0 MSLPYNPFYFPLRLTESYVAAGKILYFLYGCRKGEDPAETEPSTAESKANEMMKLFLTTLLGIVFGFFLAISMPTLSLSKMNLPSGLFPSFDITYMEDKY SGLSPQALINALSSLGGRSVNSLLFHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27470			Protein of unknown function (D...		Lus10035228 [exp]	0	1
					Lus10003753 [exp]	2.0	0.9631
AT4G20040			Pectin lyase-like superfamily ...		Lus10008700 [exp]	2.8	0.9631
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10019231 [exp]	3.2	0.9523
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000682 [exp]	3.5	0.9631
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10032339 [exp]	4.0	0.9631
AT1G59610		DRP2B, CF1, ADL...	Dynamin related protein 2B, dy...		Lus10024462 [exp]	6.3	0.9132
AT4G30720		PDE327	PIGMENT DEFECTIVE 327, FAD/NAD...		Lus10010776 [exp]	7.7	0.8917
AT2G37370			unknown protein		Lus10009063 [exp]	7.9	0.9312
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10040676 [exp]	9.8	0.9355
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Lus10001430 [exp]	10.5	0.8978

Compare expression of checked genes

Lus10035228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.