Lus10035236 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G05060 70 / 8e-15 Protein kinase superfamily protein (.1)
AT5G27510 69 / 3e-14 Protein kinase superfamily protein (.1)
AT4G36950 66 / 2e-13 MAPKKK21 mitogen-activated protein kinase kinase kinase 21 (.1)
AT2G34290 66 / 3e-13 Protein kinase superfamily protein (.1)
AT2G41920 64 / 2e-12 Protein kinase superfamily protein (.1)
AT2G41910 62 / 8e-12 Protein kinase superfamily protein (.1)
AT2G42550 60 / 4e-11 Protein kinase superfamily protein (.1)
AT5G27790 59 / 6e-11 Protein kinase superfamily protein (.1)
AT3G45790 54 / 7e-09 Protein kinase superfamily protein (.1)
AT3G50310 52 / 2e-08 MKKK20, MAPKKK20 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026894 111 / 2e-30 AT3G50310 187 / 1e-57 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034242 107 / 1e-28 AT3G50310 190 / 2e-58 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034288 96 / 4e-24 AT3G50310 181 / 5e-55 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034285 94 / 1e-23 AT5G27510 183 / 6e-56 Protein kinase superfamily protein (.1)
Lus10039141 91 / 2e-22 AT3G46140 168 / 1e-49 Protein kinase superfamily protein (.1)
Lus10034216 88 / 2e-22 AT5G27510 107 / 2e-28 Protein kinase superfamily protein (.1)
Lus10029023 83 / 4e-20 AT3G50310 147 / 8e-43 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10013791 83 / 7e-20 AT3G45790 108 / 1e-28 Protein kinase superfamily protein (.1)
Lus10017114 79 / 3e-18 AT3G50310 127 / 3e-34 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G139200 67 / 9e-14 AT5G67080 305 / 2e-102 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.007G044800 67 / 1e-13 AT5G67080 350 / 6e-120 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.001G042400 61 / 1e-11 AT3G50310 236 / 5e-75 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.009G131100 61 / 2e-11 AT3G50310 200 / 4e-62 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.003G184200 59 / 7e-11 AT4G36950 246 / 8e-79 mitogen-activated protein kinase kinase kinase 21 (.1)
Potri.004G171500 57 / 4e-10 AT3G50310 202 / 7e-63 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.005G139300 56 / 1e-09 AT5G67080 329 / 6e-112 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.018G057700 48 / 6e-07 AT4G32830 544 / 0.0 ataurora1 (.1)
Potri.006G235000 47 / 1e-06 AT4G32830 553 / 0.0 ataurora1 (.1)
Potri.008G040800 44 / 1e-05 AT1G16670 289 / 5e-96 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10035236 pacid=23162528 polypeptide=Lus10035236 locus=Lus10035236.g ID=Lus10035236.BGIv1.0 annot-version=v1.0
ATGGCCGTTAAATCATCGAGGAATTTGAGCCTTCTGATGGAGCACCAAATTCCTAACAAGTTCGCTGGTGCTCAGGAGATAATCCAGTGTTTCGGCTGTA
GTAGCGTGATCTCCAGTGATCATTCATATGGTCCAACCACGACTTACAATTTGCTTATGGAATACGCCACCGGAGGGTTGCTCCCCGATTTGATCGACCT
GTTACAAGGGAAGAAGAAACAACAAGACGGAGGAGGCCGCGGGAGAAGCAGAATTATTAATGCCGGAGATCGGTACACTCACTGCGACATCAAGCCTGAC
AACATTCTGGTTTTTCTGAAACCGGACAGTCCTCTCTGCCATACGAAGATTGCCGATTTCGGGATTGCTGTGAAGTCACCACTGAGGTGGCGGCACCCTT
GTAGAGGGACACTGAGATACTTACCGCCAGAGGTGGTTGTTTCAGGAGATGTTTCGCCGGCCATGGACATATGA
AA sequence
>Lus10035236 pacid=23162528 polypeptide=Lus10035236 locus=Lus10035236.g ID=Lus10035236.BGIv1.0 annot-version=v1.0
MAVKSSRNLSLLMEHQIPNKFAGAQEIIQCFGCSSVISSDHSYGPTTTYNLLMEYATGGLLPDLIDLLQGKKKQQDGGGRGRSRIINAGDRYTHCDIKPD
NILVFLKPDSPLCHTKIADFGIAVKSPLRWRHPCRGTLRYLPPEVVVSGDVSPAMDI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G34290 Protein kinase superfamily pro... Lus10035236 0 1
AT1G34050 Ankyrin repeat family protein ... Lus10024844 4.7 0.8859
AT3G02850 SKOR STELAR K+ outward rectifier, S... Lus10035498 4.7 0.8960
AT1G35670 CPK11, ATCDPK2,... calcium-dependent protein kina... Lus10014820 5.2 0.8809
AT5G01300 PEBP (phosphatidylethanolamine... Lus10002212 10.7 0.8690
AT3G60330 AHA7 H\(+\)-ATPase 7, H\(+\)-ATPase... Lus10040166 15.4 0.8426
AT1G29380 Carbohydrate-binding X8 domain... Lus10015259 16.4 0.8784
AT5G41850 alpha/beta-Hydrolases superfam... Lus10032373 16.9 0.8620
Lus10000650 17.9 0.8597
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Lus10027870 19.4 0.8258
AT3G54200 Late embryogenesis abundant (L... Lus10031555 19.9 0.8461

Lus10035236 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.