Lus10035239 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14830 58 / 1e-11 HSP1 heat shock protein 20-like protein 1, unknown protein
AT3G22530 57 / 6e-11 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000009 189 / 5e-64 AT3G22530 59 / 6e-14 unknown protein
Lus10004901 77 / 2e-18 AT3G22530 167 / 9e-52 unknown protein
Lus10010549 0 / 1 AT3G22530 164 / 1e-51 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G086400 76 / 5e-18 AT3G22530 165 / 3e-51 unknown protein
Potri.008G154100 68 / 2e-15 AT3G22530 140 / 2e-42 unknown protein
Potri.002G051100 53 / 1e-09 AT3G22530 127 / 3e-37 unknown protein
PFAM info
Representative CDS sequence
>Lus10035239 pacid=23162522 polypeptide=Lus10035239 locus=Lus10035239.g ID=Lus10035239.BGIv1.0 annot-version=v1.0
ATGAAGTTTCATCCAATGCCCAAAAGGAGGAACAACGTCAAAATCCAGTACTATGTAGACCACGGTGGCGTCAACAATCAGAGAGGAGACAGTGGCGGAG
AGTTGTCCTCCTCCGGCGGCGACGGAAACAAGAAGCTGAGAAGGCTGCCCCAAATCTTCAATCGAGTGCGGGAACTACCGTTCCGGTCGATGCTGACGTA
CGTGCCGGTGGAGGAAAGCACTGATTGCTTCCGGTTCGTGGCGGAGGCACACTATCGAAACCCATCCCGGGGTTACCAAAATCGTGATTCGACCCAACGG
GTACTTCGAATTGCCGTCGTTGGATGA
AA sequence
>Lus10035239 pacid=23162522 polypeptide=Lus10035239 locus=Lus10035239.g ID=Lus10035239.BGIv1.0 annot-version=v1.0
MKFHPMPKRRNNVKIQYYVDHGGVNNQRGDSGGELSSSGGDGNKKLRRLPQIFNRVRELPFRSMLTYVPVEESTDCFRFVAEAHYRNPSRGYQNRDSTQR
VLRIAVVG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22530 unknown protein Lus10035239 0 1
AT3G22530 unknown protein Lus10000009 1.4 0.7979
AT2G46620 P-loop containing nucleoside t... Lus10006295 7.5 0.7522
AT4G37300 MEE59 maternal effect embryo arrest ... Lus10018201 8.7 0.7489
AT1G33560 ADR1 ACTIVATED DISEASE RESISTANCE 1... Lus10032759 9.6 0.7473
AT5G61380 AtTOC1, TOC1, A... PSEUDO-RESPONSE REGULATOR 1, T... Lus10015720 10.5 0.7442
AT3G02130 TOAD2, RPK2, CL... TOADSTOOL 2, clv3 peptide inse... Lus10036899 16.7 0.7207
AT3G62930 Thioredoxin superfamily protei... Lus10029441 21.4 0.6893
Lus10020211 24.5 0.6776
AT2G46150 Late embryogenesis abundant (L... Lus10036403 25.0 0.7386
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Lus10040961 29.4 0.6764

Lus10035239 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.