Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38880 128 / 1e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005085 [exp] 161 / 3e-47 AT5G38880 1081 / 0.0 unknown protein Lus10034366 [exp] 152 / 3e-44 AT5G38880 1121 / 0.0 unknown protein Lus10034622 [exp] 139 / 3e-40 AT5G38880 301 / 4e-93 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G114600 [exp] 137 / 9e-39 AT5G38880 1110 / 0.0 unknown protein Potri.017G100300 [exp] 133 / 2e-37 AT5G38880 1120 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035250 pacid=23162590 polypeptide=Lus10035250 locus=Lus10035250.g ID=Lus10035250.BGIv1.0 annot-version=v1.0 ATGCAGAGCTCGTCGAGTTCGTTGGCCCAACCAGATGCCATACTGGAATGGCTTCACAAGGATATGGAGTACAGGCCCCTGGGTCCTTACACTACTTCTT CAACTAACAAGTCCCAGCTACCCTCCGTCGATGCGCTCTGGAAGATTTGTCGCGGGAACATGATTCCGGTTTGGAGTTTCTTGATCAATAGAGTGAAATC AGAGAAGATGGTGGAGAGTATAAGGAAGAACATCACGGTACACGGTGGTGATGGTCTTCGTCGTGCTGAACGTGGGAGTAAAGGTGGTGGTAGGAGGAAG GAGAGGCAGCTGGTGGGGAGGTATCTATAG
AA sequence Show only first row Show all	>Lus10035250 pacid=23162590 polypeptide=Lus10035250 locus=Lus10035250.g ID=Lus10035250.BGIv1.0 annot-version=v1.0 MQSSSSSLAQPDAILEWLHKDMEYRPLGPYTTSSTNKSQLPSVDALWKICRGNMIPVWSFLINRVKSEKMVESIRKNITVHGGDGLRRAERGSKGGGRRK ERQLVGRYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38880			unknown protein		Lus10035250 [exp]	0	1
AT5G38880			unknown protein		Lus10035251 [exp]	1.4	0.7494
AT3G50530		CRK	CDPK-related kinase (.1.2)		Lus10002966 [exp]	9.3	0.6221
AT1G22460			O-fucosyltransferase family pr...		Lus10020943 [exp]	17.7	0.6490
AT2G28150			Domain of unknown function (DU...		Lus10016150 [exp]	21.3	0.6879
AT5G23720		PHS1	PROPYZAMIDE-HYPERSENSITIVE 1, ...		Lus10043195 [exp]	27.0	0.6728
AT1G15750		TPL, WSIP1	WUS-INTERACTING PROTEIN 1, TOP...		Lus10001951 [exp]	33.7	0.6741
AT3G13690			Protein kinase protein with ad...		Lus10006148 [exp]	34.1	0.6476
AT2G39930		ATISA1, ISA1	ARABIDOPSIS THALIANA ISOAMYLAS...		Lus10021586 [exp]	37.0	0.6670
AT3G52570			alpha/beta-Hydrolases superfam...		Lus10022689 [exp]	44.7	0.6607
AT1G63700		EMB71, MAPKKK4,...	YODA, MAP KINASE KINASE KINASE...		Lus10024645 [exp]	46.3	0.6470

Compare expression of checked genes

Lus10035250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.