Lus10035259 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68185 143 / 4e-42 Ubiquitin-like superfamily protein (.1)
AT5G55856 51 / 2e-08 Ubiquitin-like superfamily protein (.1)
AT4G26840 49 / 9e-08 ATSUMO1, SUMO1, SUM1 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1)
AT5G55170 49 / 1e-07 ATSUMO3, SUMO3, SUM3 small ubiquitin-like modifier 3 (.1)
AT5G55160 45 / 2e-06 ATSUMO2, SUMO2, SUM2 small ubiquitin-like modifier 2 (.1.2)
AT2G32765 40 / 0.0002 ATSUMO5, SUM5 SUMO 5, small ubiquitinrelated modifier 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000234 398 / 3e-142 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1)
Lus10034627 398 / 3e-142 AT1G68185 154 / 1e-46 Ubiquitin-like superfamily protein (.1)
Lus10043185 49 / 1e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
Lus10032560 49 / 1e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
Lus10032561 49 / 1e-07 AT5G55160 174 / 4e-58 small ubiquitin-like modifier 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G118900 140 / 5e-41 AT1G68185 164 / 7e-51 Ubiquitin-like superfamily protein (.1)
Potri.002G224700 51 / 3e-08 AT4G26840 170 / 1e-56 ARABIDOPSIS THALIANA SMALL UBIQUITIN-LIKE MODIFIER 1, small ubiquitin-like modifier 1 (.1)
Potri.002G224800 49 / 1e-07 AT5G55160 172 / 3e-57 small ubiquitin-like modifier 2 (.1.2)
Potri.014G158300 49 / 1e-07 AT5G55160 171 / 5e-57 small ubiquitin-like modifier 2 (.1.2)
Potri.014G190300 47 / 1e-06 AT5G55160 168 / 7e-56 small ubiquitin-like modifier 2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence
>Lus10035259 pacid=23162544 polypeptide=Lus10035259 locus=Lus10035259.g ID=Lus10035259.BGIv1.0 annot-version=v1.0
ATGATTCGATATCTTAGCCAATCCGGCTTAGGTTTTCGTTTTCCTTTCTCCTATTCTAAATCTACTGAATGCGAGAATGTGGCTCACTCTTTGCAGGCGG
ATTTGAATGAAGAACTCGAGCCTTTGTTCGATTACCGGCGTGTTCAACCGACGAATTTCGTCTGCCTCGACGATGATGAATCACCGGTTTGTGCTGCCAA
GAAACGGAAAAAGGATGTCAAACCAGTTATTGGCAATGCAGAAGACGATGAGGTGGAGGTCATAGAGGTCGTCAAGCGTACTGAAGAAGAGGAAGAGGAA
GACTGGCTACCTCCTCCGCCTAAGGTTTCTGTCAATCCCCGGAAGCAGCATTGTGAAGATAAAACGGTTACAAAACTAAGGTTGAGAACAGAGGAGCTTC
TGCAATCTCTTGCGAAATCAGCTAATCAAGTGTTTCTAGCCCCTGAAGATTTTAAAACAAAGATTCCACTAGAGGAATCTGATCCAAATGTTGCAGACCC
TCTCAGGGAGACAGCTAAAACTGTAAATCCTGCTGCTGAAAGGGCTAAAATAGTAATATCTGTTCAAGGCCAAGATGGACTGAAGACATACCGTCTTTAC
AAGGATGACAAATTTGAGGCATTCTTCAAGAAGTATGCAGAAAGGGCTAATCTCAAGGTTGAGGAGCTGGTGTTTACCTTCGACGGTGACAAAATTGGTC
TGAAAGAAACACCTTCTAGCCTTGACATGGAAGACGAGGACATGATTGAGGTGCACTCTAAGAAACCCCTCAAATAA
AA sequence
>Lus10035259 pacid=23162544 polypeptide=Lus10035259 locus=Lus10035259.g ID=Lus10035259.BGIv1.0 annot-version=v1.0
MIRYLSQSGLGFRFPFSYSKSTECENVAHSLQADLNEELEPLFDYRRVQPTNFVCLDDDESPVCAAKKRKKDVKPVIGNAEDDEVEVIEVVKRTEEEEEE
DWLPPPPKVSVNPRKQHCEDKTVTKLRLRTEELLQSLAKSANQVFLAPEDFKTKIPLEESDPNVADPLRETAKTVNPAAERAKIVISVQGQDGLKTYRLY
KDDKFEAFFKKYAERANLKVEELVFTFDGDKIGLKETPSSLDMEDEDMIEVHSKKPLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G68185 Ubiquitin-like superfamily pro... Lus10035259 0 1
AT1G01950 AtKINUb, ARK2 Arabidopsis thaliana KINESIN U... Lus10037965 2.0 0.7937
AT5G43900 XI-6, XI-2, ATM... MYOSIN XI-6, MYOSIN X1 2, ARAB... Lus10043153 8.8 0.7791
AT3G54710 ATCDT1B, CDT1B,... ARABIDOPSIS HOMOLOG OF YEAST C... Lus10040505 14.2 0.7417
AT5G17520 MEX1, RCP1 MALTOSE EXCESS 1, root cap 1 (... Lus10020364 25.3 0.6893
AT4G37250 Leucine-rich repeat protein ki... Lus10011509 26.7 0.5943
AT3G28670 oxidoreductase, zinc-binding d... Lus10042926 27.0 0.6694
AT1G46264 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcr... Lus10042646 33.0 0.7187
AT5G27230 Frigida-like protein (.1) Lus10033828 40.2 0.6984
AT1G54510 ATNEK1 NIMA-related serine/threonine ... Lus10001783 44.5 0.6819
AT1G16590 REV7, ATREV7 DNA-binding HORMA family prote... Lus10006836 48.3 0.6251

Lus10035259 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.