Plant FIBer expression Database

Lus10035270 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15020 108 / 2e-28 QSO2, ATQSOX1 quiescin-sulfhydryl oxidase 1 (.1.2)
AT2G01270 103 / 1e-26 ATQSOX2 quiescin-sulfhydryl oxidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034639
[exp]
152 / 1e-44 AT1G15020 662 / 0.0 quiescin-sulfhydryl oxidase 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G127300
[exp]
130 / 1e-36 AT1G15020 695 / 0.0 quiescin-sulfhydryl oxidase 1 (.1.2)
Potri.010G115700
[exp]
108 / 1e-28 AT2G01270 660 / 0.0 quiescin-sulfhydryl oxidase 2 (.1)
PFAM info
Representative CDS sequence
>Lus10035270 pacid=23162594 polypeptide=Lus10035270 locus=Lus10035270.g ID=Lus10035270.BGIv1.0 annot-version=v1.0
ATGAAGGAAGAAGCAACTTTAGGGACCGGCGACCCTAAGTTCCCCAAGATGACCTGGCCTCCGAAACAACTTTGCCCTGCATGTTATCGCTCTGCTAGCA
GCAGTGAGGTTGACTGGGATTTGGATGAAGTATACAGATTCATGGTGAACTACTATGGCAGAACACTGGTCTCTTTGTACAATGAGAAGGATGTTGTTGG
GAAAGAAGTTGTGGTCGGTTTGAGCGAAGATACAGTGGGATCGACGAATGCAGTTGTGGTTCCAGTGGGGGCTGCATTGGCGATTGCCCTAGCTAGCTGT
GCTTTCGGAGCTCTTGCTTGTTATTGGCGGTCACGGCAGAAGAGTCGGAAGTATTACCACCAACTATACTCTTTAAAGAACATATAA
AA sequence
>Lus10035270 pacid=23162594 polypeptide=Lus10035270 locus=Lus10035270.g ID=Lus10035270.BGIv1.0 annot-version=v1.0
MKEEATLGTGDPKFPKMTWPPKQLCPACYRSASSSEVDWDLDEVYRFMVNYYGRTLVSLYNEKDVVGKEVVVGLSEDTVGSTNAVVVPVGAALAIALASC
AFGALACYWRSRQKSRKYYHQLYSLKNI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15020 QSO2, ATQSOX1 quiescin-sulfhydryl oxidase 1 ... Lus10035270
[exp]
0 1
AT3G02740 Eukaryotic aspartyl protease f... Lus10041103
[exp]
8.1 0.7962
AT5G16510 RGP5 reversibly glycosylated protei... Lus10009555
[exp]
8.1 0.7821
AT1G23750 Nucleic acid-binding, OB-fold-... Lus10030617
[exp]
9.1 0.8332
AT1G19440 KCS4 3-ketoacyl-CoA synthase 4 (.1) Lus10042318
[exp]
9.8 0.8396
AT5G13050 5-FCL 5-formyltetrahydrofolate cyclo... Lus10004254
[exp]
18.3 0.8129
AT5G08160 ATPK3 serine/threonine protein kinas... Lus10013493
[exp]
22.6 0.7728
AT3G55260 HEXO1, ATHEX2 beta-hexosaminidase 1 (.1) Lus10030323
[exp]
26.1 0.7969
AT5G23340 RNI-like superfamily protein (... Lus10040998
[exp]
26.5 0.7603
AT5G50850 MAB1 MACCI-BOU, Transketolase famil... Lus10043191
[exp]
29.8 0.7811
AT4G09720 AtRABG3a RAB GTPase homolog G3A (.1.2.3... Lus10006059
[exp]
34.4 0.7938

Lus10035270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.