Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04200 67 / 6e-15 RmlC-like cupins superfamily protein (.1) AT5G39190 60 / 2e-12 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G39130 60 / 2e-12 RmlC-like cupins superfamily protein (.1) AT5G39160 59 / 3e-12 RmlC-like cupins superfamily protein (.1.2.3) AT3G04150 59 / 6e-12 RmlC-like cupins superfamily protein (.1.2) AT3G04170 58 / 1e-11 RmlC-like cupins superfamily protein (.1) AT3G04190 54 / 3e-10 RmlC-like cupins superfamily protein (.1) AT5G38960 52 / 1e-09 RmlC-like cupins superfamily protein (.1) AT3G04180 52 / 1e-09 RmlC-like cupins superfamily protein (.1) AT3G05950 52 / 2e-09 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030049 [exp] 99 / 2e-27 AT5G39160 191 / 8e-62 RmlC-like cupins superfamily protein (.1.2.3) Lus10030048 [exp] 98 / 5e-27 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Lus10035278 [exp] 96 / 3e-26 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1) Lus10026962 [exp] 95 / 1e-25 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1) Lus10035279 [exp] 94 / 3e-25 AT5G39160 244 / 2e-82 RmlC-like cupins superfamily protein (.1.2.3) Lus10029010 [exp] 82 / 7e-21 AT3G05950 250 / 2e-84 RmlC-like cupins superfamily protein (.1) Lus10015128 [exp] 76 / 2e-18 AT3G05950 238 / 7e-80 RmlC-like cupins superfamily protein (.1) Lus10034254 [exp] 74 / 9e-18 AT5G39160 251 / 6e-85 RmlC-like cupins superfamily protein (.1.2.3) Lus10030047 [exp] 74 / 2e-17 AT3G05950 256 / 7e-87 RmlC-like cupins superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G162200 [exp] 73 / 2e-17 AT5G39190 246 / 4e-83 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.011G163216 [exp] 71 / 9e-17 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163300 [exp] 70 / 2e-16 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.001G465100 [exp] 66 / 7e-15 AT5G39160 253 / 8e-86 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163800 [exp] 64 / 8e-14 AT5G39130 255 / 1e-86 RmlC-like cupins superfamily protein (.1) Potri.001G464500 [exp] 64 / 1e-13 AT5G39190 203 / 2e-65 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.001G464000 [exp] 63 / 1e-13 AT5G39190 231 / 4e-77 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.011G163200 [exp] 62 / 3e-13 AT3G05950 266 / 5e-91 RmlC-like cupins superfamily protein (.1) Potri.011G162932 [exp] 62 / 3e-13 AT3G05950 268 / 1e-91 RmlC-like cupins superfamily protein (.1) Potri.009G140400 [exp] 62 / 6e-13 AT5G39110 247 / 3e-83 RmlC-like cupins superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035277 pacid=23170557 polypeptide=Lus10035277 locus=Lus10035277.g ID=Lus10035277.BGIv1.0 annot-version=v1.0 ATGGCGAATCAGGTTGTTATGTTGACCTCAATGCTACTGGTAGCGTTGTTCTGCTACTTTGCCTCCGCCTCTGATCCTTCTCCTCGTCAGGACTTCTGCG TAGCCGGTTCGATGGACCAAGTCAAAATGAATGGCTTTGCTTGCAAGGATCCTACAACGGTCACAGCAAGCGATTTCCCCTTCGGCGGGGTCCACATACC GGCGAACACTACTACCAATCCCCAAGGAAGTCCCGGCGACTGTGGCTGA
AA sequence Show only first row Show all	>Lus10035277 pacid=23170557 polypeptide=Lus10035277 locus=Lus10035277.g ID=Lus10035277.BGIv1.0 annot-version=v1.0 MANQVVMLTSMLLVALFCYFASASDPSPRQDFCVAGSMDQVKMNGFACKDPTTVTASDFPFGGVHIPANTTTNPQGSPGDCG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04200			RmlC-like cupins superfamily p...		Lus10035277 [exp]	0	1

Compare expression of checked genes

Lus10035277 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.