Lus10035283 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42570 179 / 4e-57 B-cell receptor-associated 31-like (.1)
AT1G11905 139 / 1e-41 B-cell receptor-associated protein 31-like (.1.2)
AT5G48660 99 / 6e-26 B-cell receptor-associated protein 31-like (.1)
AT3G07190 91 / 1e-22 B-cell receptor-associated protein 31-like (.1)
AT3G20450 85 / 3e-21 B-cell receptor-associated protein 31-like (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030043 271 / 7e-94 AT5G42570 241 / 1e-81 B-cell receptor-associated 31-like (.1)
Lus10031546 197 / 4e-64 AT5G42570 287 / 3e-99 B-cell receptor-associated 31-like (.1)
Lus10015132 171 / 5e-54 AT5G42570 258 / 7e-88 B-cell receptor-associated 31-like (.1)
Lus10020025 143 / 6e-43 AT1G11905 225 / 9e-75 B-cell receptor-associated protein 31-like (.1.2)
Lus10011842 99 / 6e-26 AT5G48660 270 / 1e-92 B-cell receptor-associated protein 31-like (.1)
Lus10022777 94 / 6e-24 AT5G48660 271 / 9e-93 B-cell receptor-associated protein 31-like (.1)
Lus10038188 91 / 8e-23 AT3G07190 265 / 1e-90 B-cell receptor-associated protein 31-like (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G007900 170 / 2e-53 AT5G42570 259 / 3e-88 B-cell receptor-associated 31-like (.1)
Potri.011G007200 166 / 5e-52 AT5G42570 278 / 1e-95 B-cell receptor-associated 31-like (.1)
Potri.014G154800 133 / 4e-39 AT5G42570 152 / 2e-46 B-cell receptor-associated 31-like (.1)
Potri.014G191500 114 / 1e-31 AT5G48660 237 / 2e-79 B-cell receptor-associated protein 31-like (.1)
Potri.011G089100 110 / 2e-31 AT5G42570 140 / 5e-43 B-cell receptor-associated 31-like (.1)
Potri.002G245300 106 / 7e-29 AT3G07190 239 / 3e-80 B-cell receptor-associated protein 31-like (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05529 Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence
>Lus10035283 pacid=23170655 polypeptide=Lus10035283 locus=Lus10035283.g ID=Lus10035283.BGIv1.0 annot-version=v1.0
ATGATACAGCTTCTCTACGGGGTGATCTTCGGCCAGATGGTGCTGATCCTGTTGTTGCTGTTCAAGACGCCGCTGCGGAAGCTGGTGATCATGGCCTTGG
ATCGGCTCAAGCGGGGGAGAGGCCCCATAGTTGTGAAAACTGTCGCCGGAACGCTCCTGCTCGTCCTTTCCTCCAGCCTTTACAGTATGTTCACGATTCA
GAATCGCTCCATTGAGGCCGGCGCTCCCAATCCTACCGACCAGGTCCTCATGTCCCGGCACCTCCTCGAAGCGTCTCTTATGGGGTTCGTGCTGTTCCTT
TCACTGATGATCGACAGGCTACACCATTACATCAGGGAGCTTCGCCAGCTAAGGAAGACAATGGAGACCGCCAAGAAACAAACTCGAGGAGTAGACGATG
CCAAAACCAGCAGCAGCAGCAGCAATTCAGACGAGATGAAAGCACTCGAAGAAGAAGCTGCTGCTCTACGCAGTAAGGTGAAGCAACTGGAAGCCGAATG
TGAAGCCAAGAACAAGGAAATCAAGGCTGCAGAAGATATATTCGAGCCCAAGAAGGACATGTAG
AA sequence
>Lus10035283 pacid=23170655 polypeptide=Lus10035283 locus=Lus10035283.g ID=Lus10035283.BGIv1.0 annot-version=v1.0
MIQLLYGVIFGQMVLILLLLFKTPLRKLVIMALDRLKRGRGPIVVKTVAGTLLLVLSSSLYSMFTIQNRSIEAGAPNPTDQVLMSRHLLEASLMGFVLFL
SLMIDRLHHYIRELRQLRKTMETAKKQTRGVDDAKTSSSSSNSDEMKALEEEAAALRSKVKQLEAECEAKNKEIKAAEDIFEPKKDM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42570 B-cell receptor-associated 31-... Lus10035283 0 1
AT2G25250 unknown protein Lus10041025 2.8 0.9014
Lus10018622 4.0 0.8661
AT5G13860 ELC-LIKE, ATELC... ELCH-like (.1) Lus10041612 8.1 0.8555
AT1G08250 AtADT6, ADT6 Arabidopsis thaliana arogenate... Lus10019526 12.8 0.8520
AT3G61460 BRH1 brassinosteroid-responsive RIN... Lus10014758 13.2 0.8489
AT1G78080 AP2_ERF CAF1, RAP2.4, W... wound induced dedifferentiatio... Lus10016801 15.2 0.8379
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10012224 17.5 0.8291
AT1G78080 AP2_ERF CAF1, RAP2.4, W... wound induced dedifferentiatio... Lus10022497 18.2 0.8330
AT2G22500 UCP5, ATPUMP5, ... DICARBOXYLATE CARRIER 1, PLANT... Lus10009270 20.1 0.8458
AT5G11070 unknown protein Lus10001943 20.8 0.8313

Lus10035283 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.