Lus10035290 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15440 111 / 1e-29 CYP74B2, HPL1 hydroperoxide lyase 1 (.1)
AT5G42650 70 / 1e-14 CYP74A, AOS, DDE2 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030032 148 / 4e-43 AT4G15440 423 / 2e-146 hydroperoxide lyase 1 (.1)
Lus10030033 145 / 9e-42 AT4G15440 442 / 7e-154 hydroperoxide lyase 1 (.1)
Lus10035289 141 / 2e-40 AT4G15440 443 / 2e-154 hydroperoxide lyase 1 (.1)
Lus10030029 127 / 3e-35 AT4G15440 481 / 3e-169 hydroperoxide lyase 1 (.1)
Lus10015138 115 / 7e-31 AT4G15440 378 / 2e-128 hydroperoxide lyase 1 (.1)
Lus10035294 103 / 1e-29 AT4G15440 98 / 4e-26 hydroperoxide lyase 1 (.1)
Lus10031540 110 / 1e-28 AT4G15440 467 / 3e-163 hydroperoxide lyase 1 (.1)
Lus10018791 74 / 5e-16 AT5G42650 615 / 0.0 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Lus10032739 73 / 2e-15 AT5G42650 496 / 8e-173 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G155800 120 / 9e-33 AT4G15440 507 / 6e-179 hydroperoxide lyase 1 (.1)
Potri.002G130700 63 / 3e-12 AT5G42650 693 / 0.0 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Potri.004G149000 54 / 4e-09 AT5G42650 492 / 3e-171 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Potri.014G038700 54 / 5e-09 AT5G42650 658 / 0.0 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Potri.009G109700 52 / 3e-08 AT5G42650 479 / 2e-166 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Potri.004G148900 50 / 2e-07 AT5G42650 499 / 2e-174 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Potri.004G148600 42 / 4e-05 AT5G42650 442 / 3e-152 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00067 p450 Cytochrome P450
Representative CDS sequence
>Lus10035290 pacid=23170523 polypeptide=Lus10035290 locus=Lus10035290.g ID=Lus10035290.BGIv1.0 annot-version=v1.0
ATGGCGGGTCGACCTAACTTTCGCCTCATTCAAACAAATGCCGTTGATTCGGTCATTTGTTTACGAGACTCTTCGGCACGAAGCGCCGATCCCAAACCAA
TTTGCCCGGGCCAGAAAGGATTTCAAGCCCAACTCAAGCGAGGCATCGTACGAGATCAAGAAGGGCGAGCTATTGTACGGTACCAGCCGTTGGTGATGCG
GGACCCTACGGTTTTTGATGACCCAGATAGCTTCAAACCTGACAAGTTCCTGGGCGAGAAGGGGGTGGAGTTGCTGAATTTCTTGTACTGGTCGAAAGGG
CCAGAGACCGGTTCGACCAGCGAGTCAAATAAACAGTGTGCGAGGAAAGAGCACGTGACAGTAACTGGGTCGTTGTTTGTGGCACACTTCCTTCAACGGT
ATGATTCCATCAGTGGAGAAGGTTCGACGATCAAGGCCGTTGAAAGGGCCAAGTGA
AA sequence
>Lus10035290 pacid=23170523 polypeptide=Lus10035290 locus=Lus10035290.g ID=Lus10035290.BGIv1.0 annot-version=v1.0
MAGRPNFRLIQTNAVDSVICLRDSSARSADPKPICPGQKGFQAQLKRGIVRDQEGRAIVRYQPLVMRDPTVFDDPDSFKPDKFLGEKGVELLNFLYWSKG
PETGSTSESNKQCARKEHVTVTGSLFVAHFLQRYDSISGEGSTIKAVERAK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G15440 CYP74B2, HPL1 hydroperoxide lyase 1 (.1) Lus10035290 0 1
AT5G65110 ATACX2, ACX2 acyl-CoA oxidase 2 (.1.2) Lus10041711 16.2 0.8768
AT2G20210 RNI-like superfamily protein (... Lus10022840 71.4 0.8435
AT4G39830 Cupredoxin superfamily protein... Lus10036957 100.7 0.8157
AT1G05577 Domain of unknown function (DU... Lus10003921 105.3 0.8287
AT3G54340 MADS AP3, ATAP3 APETALA 3, K-box region and MA... Lus10010630 169.0 0.7956
AT4G28556 RIC7 PAK-box/P21-Rho-binding family... Lus10008243 178.5 0.7842
AT4G28940 Phosphorylase superfamily prot... Lus10034939 204.3 0.7824
AT5G67530 ATPUB49 plant U-box 49 (.1) Lus10004731 212.0 0.8025

Lus10035290 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.