Lus10035292 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G34080 86 / 4e-20 Cysteine proteinases superfamily protein (.1)
AT3G49340 82 / 2e-18 Cysteine proteinases superfamily protein (.1)
AT3G48340 80 / 7e-18 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT5G45890 79 / 2e-17 SAG12 senescence-associated gene 12 (.1)
AT3G48350 79 / 2e-17 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1)
AT4G11310 76 / 2e-16 RD21A, RD21 Papain family cysteine protease (.1)
AT4G11320 76 / 2e-16 Papain family cysteine protease (.1)
AT1G29080 74 / 7e-16 Papain family cysteine protease (.1)
AT4G36880 74 / 1e-15 CP1 cysteine proteinase1 (.1)
AT3G19390 74 / 1e-15 Granulin repeat cysteine protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028501 101 / 1e-25 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10028502 101 / 1e-25 AT5G45890 394 / 3e-137 senescence-associated gene 12 (.1)
Lus10026073 100 / 3e-25 AT5G45890 393 / 5e-137 senescence-associated gene 12 (.1)
Lus10029799 100 / 3e-25 AT5G45890 393 / 3e-137 senescence-associated gene 12 (.1)
Lus10003275 100 / 3e-25 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10020722 99 / 1e-24 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10004781 98 / 1e-24 AT5G45890 227 / 7e-73 senescence-associated gene 12 (.1)
Lus10020730 98 / 2e-24 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10026362 97 / 3e-24 AT5G45890 396 / 2e-138 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G118200 93 / 1e-22 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1)
Potri.007G075100 91 / 5e-22 AT5G45890 371 / 4e-129 senescence-associated gene 12 (.1)
Potri.007G075300 91 / 8e-22 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1)
Potri.013G118400 90 / 2e-21 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1)
Potri.013G126100 87 / 1e-20 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Potri.004G056050 82 / 1e-19 AT5G45890 263 / 3e-88 senescence-associated gene 12 (.1)
Potri.004G056308 82 / 2e-19 AT5G45890 254 / 7e-85 senescence-associated gene 12 (.1)
Potri.004G056301 82 / 2e-19 AT5G45890 254 / 7e-85 senescence-associated gene 12 (.1)
Potri.004G056366 84 / 4e-19 AT5G45890 416 / 5e-146 senescence-associated gene 12 (.1)
Potri.004G056000 84 / 4e-19 AT5G45890 417 / 2e-146 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
Representative CDS sequence
>Lus10035292 pacid=23170626 polypeptide=Lus10035292 locus=Lus10035292.g ID=Lus10035292.BGIv1.0 annot-version=v1.0
ATGCGGAAGTTGTTGGGCATTTTCTGCCGTGGCGGCCGTGGAAGGGATATACCAGATAACTACAGGGAAGTTAGTGCCCCTTTCGGTGCAACAATTGGTC
TACTACGACACCAAGGGAATCACCGGAGGATGCGACTATGGATTCACGGTAGCTGCGTTCGATTTCATCTTAAGAAACCAAGGTCTTACGACCGAATCGA
ACTACCCTTACAGGGGTGCAGCAAGGCGGAATTAGCGGGGCAAATCAACGGCTTCGAGATTGTGCCGGCCAATGACGAAGTTGCCTTGCTCAAGGCCGTG
GCCACCCAGCCGGTTTCGGTGTCCAGTCACGCTAATGTGTCCTGGTTCTACGATTACCGCAGTGGGATCATTTCGGGTGAGTGTGGGACTGATGTGGAGC
ATGGGGTGACGGAGGTGGGGTATGGGGGGTATGGGGAGAGCGAAGGGAAGAAGTACTGGCTGATGAAGACCTCGTGGGGAGAGCGAGGTTACTTTTGGAT
GGAGAGAGATGTGGCGGCGAAAGAAGGGATGCGTGGGATTTGTCAGTATGCTTCCTACATTACTATGTCGCGGACATAA
AA sequence
>Lus10035292 pacid=23170626 polypeptide=Lus10035292 locus=Lus10035292.g ID=Lus10035292.BGIv1.0 annot-version=v1.0
MRKLLGIFCRGGRGRDIPDNYREVSAPFGATIGLLRHQGNHRRMRLWIHGSCVRFHLKKPRSYDRIELPLQGCSKAELAGQINGFEIVPANDEVALLKAV
ATQPVSVSSHANVSWFYDYRSGIISGECGTDVEHGVTEVGYGGYGESEGKKYWLMKTSWGERGYFWMERDVAAKEGMRGICQYASYITMSRT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G34080 Cysteine proteinases superfami... Lus10035292 0 1
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10015158 5.0 0.9592
AT5G60010 ferric reductase-like transmem... Lus10019390 7.1 0.9592
AT1G04670 unknown protein Lus10004041 8.7 0.9592
Lus10040397 10.0 0.9592
Lus10006918 11.2 0.9592
Lus10007508 12.2 0.9592
AT3G53690 RING/U-box superfamily protein... Lus10042610 13.2 0.9592
Lus10027066 14.1 0.9592
AT1G22440 Zinc-binding alcohol dehydroge... Lus10009516 15.0 0.9592
AT2G25930 PYK20, ELF3 EARLY FLOWERING 3, hydroxyprol... Lus10006857 15.8 0.9573

Lus10035292 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.