Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15440 98 / 3e-26 CYP74B2, HPL1 hydroperoxide lyase 1 (.1) AT5G42650 72 / 8e-17 CYP74A, AOS, DDE2 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030029 [exp] 138 / 1e-40 AT4G15440 481 / 3e-169 hydroperoxide lyase 1 (.1) Lus10015138 [exp] 123 / 5e-35 AT4G15440 378 / 2e-128 hydroperoxide lyase 1 (.1) Lus10035289 [exp] 114 / 6e-32 AT4G15440 443 / 2e-154 hydroperoxide lyase 1 (.1) Lus10030033 [exp] 114 / 7e-32 AT4G15440 442 / 7e-154 hydroperoxide lyase 1 (.1) Lus10030032 [exp] 114 / 9e-32 AT4G15440 423 / 2e-146 hydroperoxide lyase 1 (.1) Lus10031540 [exp] 114 / 1e-31 AT4G15440 467 / 3e-163 hydroperoxide lyase 1 (.1) Lus10035290 [exp] 103 / 4e-30 AT4G15440 136 / 4e-39 hydroperoxide lyase 1 (.1) Lus10018791 [exp] 75 / 2e-17 AT5G42650 615 / 0.0 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1) Lus10032739 [exp] 71 / 3e-16 AT5G42650 496 / 8e-173 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G155800 [exp] 111 / 1e-30 AT4G15440 507 / 6e-179 hydroperoxide lyase 1 (.1) Potri.002G130700 [exp] 66 / 2e-14 AT5G42650 693 / 0.0 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1) Potri.014G038700 [exp] 57 / 4e-11 AT5G42650 658 / 0.0 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1) Potri.009G109700 [exp] 51 / 3e-09 AT5G42650 479 / 2e-166 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1) Potri.004G149000 [exp] 50 / 8e-09 AT5G42650 492 / 3e-171 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1) Potri.004G148900 [exp] 49 / 1e-08 AT5G42650 499 / 2e-174 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1) Potri.004G148600 [exp] 48 / 4e-08 AT5G42650 442 / 3e-152 DELAYED DEHISCENCE 2, CYTOCHROME P450 74A, allene oxide synthase (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035294 pacid=23170511 polypeptide=Lus10035294 locus=Lus10035294.g ID=Lus10035294.BGIv1.0 annot-version=v1.0 ATGGGGGAGAAGGGAGCGGAGTTGCTGACATACTTGTACTGGTCGAACGGGCCGCAGACCGGTTCGCCCAGCGAGTTGAACAAGCAGTGCGCGGGGAAAG AGTACGTGACCCTCACTGCGTCGTTGATTGTGGCCCACTTGTTTCGACGGTACGATTCAATCAATGGGAAAGGCTTGACGATCACAGCCGTTGAAAAGGC TAAGTGA
AA sequence Show only first row Show all	>Lus10035294 pacid=23170511 polypeptide=Lus10035294 locus=Lus10035294.g ID=Lus10035294.BGIv1.0 annot-version=v1.0 MGEKGAELLTYLYWSNGPQTGSPSELNKQCAGKEYVTLTASLIVAHLFRRYDSINGKGLTITAVEKAK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15440		CYP74B2, HPL1	hydroperoxide lyase 1 (.1)		Lus10035294 [exp]	0	1
AT5G48600		ATSMC4, SMC4, A...	ARABIDOPSIS THALIANA STRUCTURA...		Lus10030681 [exp]	2.6	0.6845
AT5G61990			Pentatricopeptide repeat (PPR)...		Lus10016725 [exp]	6.5	0.6811
AT5G49555			FAD/NAD(P)-binding oxidoreduct...		Lus10026016 [exp]	10.4	0.6261
AT2G36780			UDP-Glycosyltransferase superf...		Lus10014403 [exp]	11.0	0.6280
AT5G03770		AtKdtA, KDTA	KDO transferase A (.1)		Lus10017663 [exp]	31.7	0.5498
AT2G46990	AUX_IAA	IAA20	indole-3-acetic acid inducible...		Lus10010081 [exp]	47.5	0.6116
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10022912 [exp]	59.2	0.5898
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10035218 [exp]	61.0	0.5460
					Lus10003757 [exp]	64.9	0.6094
AT4G18050		ABCB9, PGP9	ATP-binding cassette B9, P-gly...		Lus10004583 [exp]	66.0	0.6168

Compare expression of checked genes

Lus10035294 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.