Lus10035299 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G21610 226 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT1G67600 181 / 7e-59 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 177 / 7e-57 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G61770 111 / 7e-30 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT3G12685 76 / 3e-17 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030025 239 / 2e-80 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10000883 186 / 9e-61 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10003670 185 / 5e-60 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10011373 166 / 7e-53 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10006432 165 / 3e-52 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10036984 152 / 8e-48 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10030253 115 / 4e-33 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10014550 60 / 3e-12 AT3G61770 115 / 4e-33 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001841 61 / 4e-11 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G156000 238 / 9e-81 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 231 / 3e-78 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.011G087100 218 / 5e-73 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.010G056600 177 / 3e-57 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.002G171300 111 / 5e-30 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G176100 66 / 4e-13 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Lus10035299 pacid=23170640 polypeptide=Lus10035299 locus=Lus10035299.g ID=Lus10035299.BGIv1.0 annot-version=v1.0
ATGGACGAGGTGATGACCACCGCCGACGCGACATTGGGAAGAGCGGCGCTGAAAATGGTCAGGACGGCTTCATCGGCGATTCTCTCAACTCCGACGCCTC
CGTCGTCTTCTCCTCCTTCGTCTCTGCTGCCTAGCAACCTCCCGCTGATCTCGGCCTTCCTCGCCTTCGCCCTCGCCCAGTTCCTCAAGCTCTTCACCAA
TTGGTTTAAGGAGAAGAGATGGGATTCCAAGAGGATGGTGGACTCCGGGGGGATGCCGTCTTCGCATTCCGCAACAGTGACAGCTCTCGCTATGGCTATT
GGATTGCAGGAAGGGACTGGATCCCCTGCTTTCGCCATTGCTGTTGTCCTTGCTTGTGTTGTTATGTATGATGCATCTGGGATCAGACTTCATGCTGGTC
GTCAAGCTGAATTGCTGAACCAAATTATGTGCGAGTTTCCTCCAGAACACCCCTTATCCAGTGTGAGACCTTTGCGCGAGTTACTTGGACACACTCCATT
CCAGGTCGTTGTCGGAGCAATGTTGGGATGCATAGTATCATACCTGATGAGAAACACCGACTAA
AA sequence
>Lus10035299 pacid=23170640 polypeptide=Lus10035299 locus=Lus10035299.g ID=Lus10035299.BGIv1.0 annot-version=v1.0
MDEVMTTADATLGRAALKMVRTASSAILSTPTPPSSSPPSSLLPSNLPLISAFLAFALAQFLKLFTNWFKEKRWDSKRMVDSGGMPSSHSATVTALAMAI
GLQEGTGSPAFAIAVVLACVVMYDASGIRLHAGRQAELLNQIMCEFPPEHPLSSVRPLRELLGHTPFQVVVGAMLGCIVSYLMRNTD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G21610 Acid phosphatase/vanadium-depe... Lus10035299 0 1
AT2G36680 Modifier of rudimentary (Mod(r... Lus10014395 3.2 0.8874
AT5G05987 PRA1.A2 prenylated RAB acceptor 1.A2 (... Lus10030160 3.7 0.8825
AT2G45510 CYP704A2 "cytochrome P450, family 704, ... Lus10009232 4.5 0.8772
AT3G02460 Ypt/Rab-GAP domain of gyp1p su... Lus10003047 4.5 0.8733
AT5G50430 UBC33 ubiquitin-conjugating enzyme 3... Lus10003932 6.5 0.8789
AT5G47540 Mo25 family protein (.1) Lus10017565 6.9 0.8625
AT1G14340 RNA-binding (RRM/RBD/RNP motif... Lus10030491 10.4 0.8351
AT2G38610 RNA-binding KH domain-containi... Lus10034443 12.7 0.8597
AT1G15860 Domain of unknown function (DU... Lus10013742 13.1 0.8118
AT2G21270 UFD1 ubiquitin fusion degradation 1... Lus10018057 13.9 0.8552

Lus10035299 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.