Lus10035307 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32180 190 / 2e-63 PTAC18 plastid transcriptionally active 18 (.1)
AT2G32650 190 / 2e-63 RmlC-like cupins superfamily protein (.1.2)
AT4G10300 61 / 1e-12 RmlC-like cupins superfamily protein (.1)
AT4G10290 55 / 3e-10 RmlC-like cupins superfamily protein (.1)
AT3G04300 51 / 3e-09 RmlC-like cupins superfamily protein (.1)
AT4G10280 51 / 8e-09 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030017 255 / 6e-89 AT2G32180 192 / 4e-64 plastid transcriptionally active 18 (.1)
Lus10035659 59 / 3e-11 AT4G10300 175 / 5e-57 RmlC-like cupins superfamily protein (.1)
Lus10037245 57 / 1e-10 AT4G10300 149 / 8e-47 RmlC-like cupins superfamily protein (.1)
Lus10035660 56 / 2e-10 AT4G10300 147 / 5e-46 RmlC-like cupins superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G156900 201 / 1e-67 AT2G32650 203 / 2e-68 RmlC-like cupins superfamily protein (.1.2)
Potri.013G089600 64 / 2e-13 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1)
Potri.002G254800 45 / 6e-07 AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF05899 Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence
>Lus10035307 pacid=23170479 polypeptide=Lus10035307 locus=Lus10035307.g ID=Lus10035307.BGIv1.0 annot-version=v1.0
ATGGCAAGTTTGACAGCTTCCCCAAACATAAGCTTCTTATCAGCCAGCAGCAGAAGCAATATCAAGAATCATAGCGGTCGAACCAATCGATGTCCGAGCG
TGAGAGCATCAGCAGTGCATGCGGTGAAGTCGCTCGAAGAGCTCTACAATGTGAGGGTGGAGAGGAAAGTGTTGCCTCAGCGATTGGATGAGCTCGGTGT
TTCGAGATGGTCTTCTTGGAAGACTGGCAAATGCAAGCTTCCCTGGGACTGGCATGTAGACCAGTTGGTGTACATTGAAGAAGGGGAAGTCAGGGTTGTT
CCCGAAGGCAGTAAGCGATACATGCAGTTCGTGGCTGGTGACCTCGTTCGTTACCCGAAATGGTTCGAGGCTGATCTCTGGTTCAACGGTCCTTACCAGG
AGCGTTATAGCTTCCGTGCTTATGGCGATGACTAG
AA sequence
>Lus10035307 pacid=23170479 polypeptide=Lus10035307 locus=Lus10035307.g ID=Lus10035307.BGIv1.0 annot-version=v1.0
MASLTASPNISFLSASSRSNIKNHSGRTNRCPSVRASAVHAVKSLEELYNVRVERKVLPQRLDELGVSRWSSWKTGKCKLPWDWHVDQLVYIEEGEVRVV
PEGSKRYMQFVAGDLVRYPKWFEADLWFNGPYQERYSFRAYGDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32180 PTAC18 plastid transcriptionally acti... Lus10035307 0 1
AT2G32180 PTAC18 plastid transcriptionally acti... Lus10030017 1.0 0.9550
AT5G16140 Peptidyl-tRNA hydrolase family... Lus10031901 2.0 0.9357
AT5G02710 unknown protein Lus10015040 6.1 0.8588
AT1G29510 SAUR68 SMALL AUXIN UPREGULATED 68, SA... Lus10020439 6.6 0.8878
AT2G41950 unknown protein Lus10029301 8.2 0.8770
AT2G32720 B5 #4, B5#4, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Lus10012615 9.2 0.8682
AT4G14740 Plant protein of unknown funct... Lus10002798 10.0 0.8960
AT5G02710 unknown protein Lus10003988 13.2 0.8686
AT5G14910 Heavy metal transport/detoxifi... Lus10032167 14.1 0.9102
AT1G71460 Pentatricopeptide repeat (PPR-... Lus10006174 14.6 0.7795

Lus10035307 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.