Lus10035324 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G03910 97 / 6e-25 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027730 100 / 8e-28 ND 328 / 7e-110
Lus10035559 98 / 1e-27 ND 301 / 4e-100
Lus10030000 102 / 6e-27 AT1G03910 713 / 0.0 unknown protein
Lus10027731 99 / 6e-26 AT1G03910 875 / 0.0 unknown protein
Lus10035558 98 / 2e-25 AT1G03910 870 / 0.0 unknown protein
Lus10027605 81 / 9e-21 AT1G03910 242 / 4e-77 unknown protein
Lus10021530 80 / 3e-20 AT1G03910 253 / 2e-81 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G118700 95 / 3e-24 AT1G03910 849 / 0.0 unknown protein
Potri.001G242900 68 / 6e-15 AT1G03910 250 / 1e-76 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09732 CactinC_cactus Cactus-binding C-terminus of cactin protein
Representative CDS sequence
>Lus10035324 pacid=23170468 polypeptide=Lus10035324 locus=Lus10035324.g ID=Lus10035324.BGIv1.0 annot-version=v1.0
ATGGTTCAAGGATACAAGTTCAACATCTTCTACCTGGACCTCGTGGACAAGACCACGGCTCCGACATGCACGATTGATAAAGACGGGACCAGACGAGACG
TGCATCATCAGATCGCCTTACGGGACATTGCTTTCCGTATTGTGAGCGAGGAGTGGGAGTGCTCTCACAAGAAGGGGTTCAAGTGCACGTTCGAGCGCGG
GATTCTGCATCTCTACTTAAACTTGAGACGCCATCGCTACTGTCGGTGA
AA sequence
>Lus10035324 pacid=23170468 polypeptide=Lus10035324 locus=Lus10035324.g ID=Lus10035324.BGIv1.0 annot-version=v1.0
MVQGYKFNIFYLDLVDKTTAPTCTIDKDGTRRDVHHQIALRDIAFRIVSEEWECSHKKGFKCTFERGILHLYLNLRRHRYCR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G03910 unknown protein Lus10035324 0 1
AT3G14180 Trihelix ASIL2 Arabidopsis 6B-interacting pr... Lus10029220 13.8 0.8230
AT3G56930 DHHC-type zinc finger family p... Lus10010447 46.1 0.7626
AT2G43950 OEP37, ATOEP37 ARABIDOPSIS CHLOROPLAST OUTER ... Lus10003862 48.1 0.7348
AT2G34930 disease resistance family prot... Lus10016344 58.3 0.7412
AT3G53970 proteasome inhibitor-related (... Lus10032056 65.7 0.7244
AT3G08000 RNA-binding (RRM/RBD/RNP motif... Lus10031534 70.6 0.7497
AT1G80700 unknown protein Lus10026096 94.9 0.7413
AT5G50960 ATNBP35, NBP35 nucleotide binding protein 35 ... Lus10027463 112.2 0.7458
AT3G48660 Protein of unknown function (D... Lus10041549 148.2 0.7423
AT5G14240 Thioredoxin superfamily protei... Lus10014596 176.0 0.7330

Lus10035324 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.