Lus10035325 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02920 42 / 4e-05 F-box/RNI-like superfamily protein (.1)
AT5G56440 39 / 0.001 F-box/RNI-like/FBD-like domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029999 115 / 3e-34 ND 37 / 4e-04
Lus10003943 90 / 4e-22 AT3G59160 50 / 1e-06 F-box/RNI-like superfamily protein (.1)
Lus10029997 54 / 2e-09 AT3G52680 44 / 1e-05 F-box/RNI-like/FBD-like domains-containing protein (.1.2)
Lus10035326 54 / 4e-09 AT5G27750 66 / 1e-12 F-box/FBD-like domains containing protein (.1)
Lus10025675 49 / 4e-08 AT5G53840 45 / 1e-06 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10028664 51 / 7e-08 AT5G50260 59 / 6e-09 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10029986 51 / 7e-08 AT1G20920 347 / 2e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10027507 50 / 2e-07 AT1G01580 475 / 1e-152 FERRIC CHELATE REDUCTASE DEFECTIVE 1, ferric reduction oxidase 2 (.1)
Lus10029951 49 / 2e-07 AT5G53840 45 / 9e-05 F-box/RNI-like/FBD-like domains-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G104200 44 / 1e-05 AT3G26922 97 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.011G104100 44 / 2e-05 AT3G26922 96 / 2e-22 F-box/RNI-like superfamily protein (.1)
Potri.015G002100 42 / 5e-05 AT4G03220 103 / 5e-24 Protein with RNI-like/FBD-like domains (.1)
Potri.011G104300 42 / 5e-05 AT3G26922 91 / 2e-20 F-box/RNI-like superfamily protein (.1)
Potri.012G099400 40 / 0.0002 AT5G44950 77 / 1e-14 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.017G146500 40 / 0.0002 AT5G02920 64 / 2e-11 F-box/RNI-like superfamily protein (.1)
Potri.017G146400 40 / 0.0003 AT3G28410 79 / 2e-15 F-box/RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10035325 pacid=23170568 polypeptide=Lus10035325 locus=Lus10035325.g ID=Lus10035325.BGIv1.0 annot-version=v1.0
ATGGCCACCGCCGCCACAAACTCCGGTCAGGAAGGAGAAGACCGAATTTCGACGTTACCGGACGAGATCATCCATAAGATCCTCGATCGCCTAGAGTCCC
GAGGACAGGTTGTGCAATTCAACATCCTGTCCAAAAGATGGTCCCATCTCATTCAGTCTTATCTTCTAGAATTCCGTGAAAGCTGGACTTGGCCGGCGGG
GACGGAAGACACACGCGCCGACGCAATCTTGGTCGTCAGAATTCATATTATACTTTGCTCGAAGTTCTACATCGATGTTCACAACCGCATGTGGGAATTC
CCTGCCGAGTTTTTGCTTCTTCGAGAGATTGATATCGAAATCGGAGTTGGCCAGTGCGGTTCTCCTGGTTGTGGTTGCACTGACTCCCGTGTAATAGTAT
ATAGCATCCCAATAAGCTTCTTCTTCATGACACCGAAGGGCGAGAAGCATGATTGA
AA sequence
>Lus10035325 pacid=23170568 polypeptide=Lus10035325 locus=Lus10035325.g ID=Lus10035325.BGIv1.0 annot-version=v1.0
MATAATNSGQEGEDRISTLPDEIIHKILDRLESRGQVVQFNILSKRWSHLIQSYLLEFRESWTWPAGTEDTRADAILVVRIHIILCSKFYIDVHNRMWEF
PAEFLLLREIDIEIGVGQCGSPGCGCTDSRVIVYSIPISFFFMTPKGEKHD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02920 F-box/RNI-like superfamily pro... Lus10035325 0 1
AT4G01310 Ribosomal L5P family protein (... Lus10036391 1.4 0.9870
Lus10031183 2.2 0.9871
AT3G55210 NAC ANAC063 NAC domain containing protein ... Lus10031639 3.3 0.9722
Lus10021851 4.9 0.9849
AT5G44440 FAD-binding Berberine family p... Lus10010643 5.5 0.9736
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004530 5.7 0.9849
Lus10008791 6.3 0.9849
AT2G20030 RING/U-box superfamily protein... Lus10000885 6.8 0.9106
Lus10012440 6.9 0.9849
Lus10026713 7.9 0.9811

Lus10035325 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.