Lus10035333 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05000 291 / 2e-100 AtPFA-DSP1 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
AT4G03960 267 / 4e-91 AtPFA-DSP4 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT2G32960 265 / 8e-90 AtPFA-DSP2 plant and fungi atypical dual-specificity phosphatase 2, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT3G02800 206 / 5e-67 AtPFA-DSP3 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
AT5G16480 197 / 1e-63 AtPFA-DSP5 plant and fungi atypical dual-specificity phosphatase 5, Phosphotyrosine protein phosphatases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029991 442 / 9e-160 AT1G05000 296 / 1e-102 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10031529 315 / 3e-110 AT1G05000 304 / 2e-106 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10015154 313 / 7e-109 AT1G05000 298 / 3e-103 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G159100 314 / 3e-109 AT1G05000 310 / 3e-108 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.002G224000 313 / 4e-109 AT1G05000 300 / 9e-105 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.004G002800 284 / 5e-98 AT1G05000 286 / 4e-99 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.011G021100 280 / 4e-96 AT4G03960 288 / 4e-100 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
Potri.013G086500 203 / 3e-66 AT3G02800 296 / 2e-103 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF03162 Y_phosphatase2 Tyrosine phosphatase family
Representative CDS sequence
>Lus10035333 pacid=23170543 polypeptide=Lus10035333 locus=Lus10035333.g ID=Lus10035333.BGIv1.0 annot-version=v1.0
ATGAAACTGGATCGCGATTTTCCTGCCGCCGCCGGAAAACTACATCAGCAGCAGAATCAAGACAGAGGAGAGAAAATTAGCGCAGATGAGGAGATGTGCA
AGACCATCGAAGTCGCTACCTTCATTGACTACCACCACCACCGCCGGCTGAAAATTCAGCCGGAGCTATACTCGTCGCCGGTTAATGCCGTCGACATCGT
CGGAGATGATCACGAATTGAATCTCCTCCCTCCGCTGAACTTCGCGATGGTTGATAACGGAATATTCCGGTCCGGTTTCCCCAATTCCATCAACTTCTCC
TTCGTCCAGGCTCTCGGCCTCCGGTCAATCATATGCATGTGTCCGGAGCCATATCCGGAGGCGAACGCGGAGTTTCTCAAGGAGAATGGGATTAGGCTTT
TCCAGTTCGGAATTGAAGGTTACAAGGAATCATTCGTAAACATCCCCCACGACATGATTCGAGAAGCGTTACAAGTCGTCCTTGATGTGAAGAACCACCC
GATCTTGATCCACTGCAAGCGAGGGAAGCATCGAACGGGGTGCATGGTGGGTTGCTTGAGGAAGCTGCAGAAGTGGTGCCTGTCGTCGATTTTCGACGAG
TACTCGAGGTTCGCCGCGGCAAAGGCTAGAGTGTCGGACCAAAGGTTCATGGAGTTGTTTGACGTTTCCACCTTGAACCATTTGCCTATGTCGTTTTCCT
GCTCCAGTTTTTCCAAGGAGTAG
AA sequence
>Lus10035333 pacid=23170543 polypeptide=Lus10035333 locus=Lus10035333.g ID=Lus10035333.BGIv1.0 annot-version=v1.0
MKLDRDFPAAAGKLHQQQNQDRGEKISADEEMCKTIEVATFIDYHHHRRLKIQPELYSSPVNAVDIVGDDHELNLLPPLNFAMVDNGIFRSGFPNSINFS
FVQALGLRSIICMCPEPYPEANAEFLKENGIRLFQFGIEGYKESFVNIPHDMIREALQVVLDVKNHPILIHCKRGKHRTGCMVGCLRKLQKWCLSSIFDE
YSRFAAAKARVSDQRFMELFDVSTLNHLPMSFSCSSFSKE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G05000 AtPFA-DSP1 plant and fungi atypical dual-... Lus10035333 0 1
AT4G31420 C2H2ZnF Zinc finger protein 622 (.1.2) Lus10026949 2.4 0.9613
AT2G18210 unknown protein Lus10028324 3.9 0.9711
AT1G03070 Bax inhibitor-1 family protein... Lus10022085 9.7 0.9353
AT4G02340 alpha/beta-Hydrolases superfam... Lus10001210 11.0 0.9581
AT1G10370 GST30B, ATGSTU1... GLUTATHIONE S-TRANSFERASE U17,... Lus10030805 11.8 0.9607
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10022191 14.8 0.9600
AT5G13080 WRKY ATWRKY75, WRKY7... ARABIDOPSIS THALIANA WRKY DNA-... Lus10003128 15.4 0.9573
AT4G19880 Glutathione S-transferase fami... Lus10014304 21.4 0.9607
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10005399 23.5 0.9550
AT2G26930 CMK, CMEK, ISPE... PIGMENT DEFECTIVE 277, 4-\(cyt... Lus10026783 24.0 0.9554

Lus10035333 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.