Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G03965 104 / 3e-29 RING/U-box superfamily protein (.1) AT4G22250 101 / 7e-28 RING/U-box superfamily protein (.1) AT1G62370 93 / 7e-25 RING/U-box superfamily protein (.1) AT4G13100 94 / 1e-24 RING/U-box superfamily protein (.1.2.3.4.5) AT3G25030 89 / 6e-23 RING/U-box superfamily protein (.1.2) AT3G07120 74 / 9e-17 RING/U-box superfamily protein (.1) AT5G23110 45 / 2e-06 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT1G18660 42 / 2e-05 zinc finger (C3HC4-type RING finger) family protein (.1), zinc finger (C3HC4-type RING finger) family protein (.2), zinc finger (C3HC4-type RING finger) family protein (.3), zinc finger (C3HC4-type RING finger) family protein (.4) AT3G06140 42 / 2e-05 RING/U-box superfamily protein (.1) AT4G09560 42 / 2e-05 NHL22 Protease-associated (PA) RING/U-box zinc finger family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029993 [exp] 155 / 4e-50 AT4G03965 118 / 2e-34 RING/U-box superfamily protein (.1) Lus10015152 [exp] 118 / 5e-35 AT4G03965 123 / 1e-35 RING/U-box superfamily protein (.1) Lus10025921 [exp] 72 / 4e-16 AT3G07120 117 / 3e-31 RING/U-box superfamily protein (.1) Lus10038180 [exp] 72 / 5e-16 AT3G07120 122 / 6e-33 RING/U-box superfamily protein (.1) Lus10043365 [exp] 44 / 7e-06 AT5G22750 1445 / 0.0 DNA/RNA helicase protein (.1) Lus10001530 [exp] 43 / 2e-05 AT5G23110 5981 / 0.0 Zinc finger, C3HC4 type (RING finger) family protein (.1) Lus10034030 [exp] 42 / 3e-05 AT5G19080 344 / 1e-116 RING/U-box superfamily protein (.1) Lus10022774 [exp] 40 / 0.0001 AT5G48655 153 / 7e-47 RING/U-box superfamily protein (.1.2.3) Lus10004419 [exp] 39 / 0.0002 AT3G06140 350 / 4e-119 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G224200 [exp] 121 / 5e-36 AT4G03965 116 / 7e-33 RING/U-box superfamily protein (.1) Potri.014G158900 [exp] 121 / 5e-36 AT4G22250 103 / 2e-27 RING/U-box superfamily protein (.1) Potri.004G003101 [exp] 96 / 9e-26 AT4G03965 135 / 3e-39 RING/U-box superfamily protein (.1) Potri.002G243800 [exp] 89 / 4e-22 AT3G07120 191 / 3e-57 RING/U-box superfamily protein (.1) Potri.013G025400 [exp] 44 / 5e-06 AT5G19080 303 / 5e-100 RING/U-box superfamily protein (.1) Potri.005G093000 [exp] 44 / 5e-06 AT5G23110 5932 / 0.0 Zinc finger, C3HC4 type (RING finger) family protein (.1) Potri.004G189400 [exp] 44 / 7e-06 AT5G22750 1506 / 0.0 DNA/RNA helicase protein (.1) Potri.005G036400 [exp] 43 / 8e-06 AT3G06140 296 / 2e-97 RING/U-box superfamily protein (.1) Potri.001G251900 [exp] 40 / 0.0001 AT5G01450 327 / 7e-108 RING/U-box superfamily protein (.1) Potri.018G011300 [exp] 40 / 0.0001 AT3G23280 105 / 6e-26 XB3 ortholog 5 in Arabidopsis thaliana (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035335 pacid=23170484 polypeptide=Lus10035335 locus=Lus10035335.g ID=Lus10035335.BGIv1.0 annot-version=v1.0 ATGAATCTCGCGGCGGCGCTGGCGGCGGAGCGTGAAGGGAGTACGGACGCGGCGAAGTCGTTAATGAGGCTGATAGAGGAAACGGACGGCGAGGATTGCA GGAAGAGCAGGAAGAAGAGGAGGGAAGAGGATAAGGAAGGAAGGGTAGGATCGGTATCGGGGAGAATGGGAGGAGGGGATTGGCTGTGCTGCGTGTGCAT GGAAAGGGATAAGGGCGCGGCGTTTATCCCCTGCGGGCATACTTTCTGTAGAGTTTGTTCCAAGGATCTGTGGGCTAGGAGAGGTTGCTGTCCCATTTGC AACCGTCAGATCACGGAGATTCTTGATATCTTTTGA
AA sequence Show only first row Show all	>Lus10035335 pacid=23170484 polypeptide=Lus10035335 locus=Lus10035335.g ID=Lus10035335.BGIv1.0 annot-version=v1.0 MNLAAALAAEREGSTDAAKSLMRLIEETDGEDCRKSRKKRREEDKEGRVGSVSGRMGGGDWLCCVCMERDKGAAFIPCGHTFCRVCSKDLWARRGCCPIC NRQITEILDIF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G22250			RING/U-box superfamily protein...		Lus10035335 [exp]	0	1
AT4G03965			RING/U-box superfamily protein...		Lus10029993 [exp]	1.0	0.9441
AT3G63540			Mog1/PsbP/DUF1795-like photosy...		Lus10016419 [exp]	4.0	0.9046
AT5G43050		NPQ6	NONPHOTOCHEMICAL QUENCHING 6, ...		Lus10038888 [exp]	4.0	0.8585
AT2G01818			PLATZ transcription factor fam...		Lus10030763 [exp]	5.1	0.8383
AT1G30910			Molybdenum cofactor sulfurase ...		Lus10007754 [exp]	6.0	0.8463
AT3G55370	DOF	OBP3, AtDof3. 6	OBF-binding protein 3 (.1.2.3)		Lus10038310 [exp]	6.6	0.8023
AT1G35420			alpha/beta-Hydrolases superfam...		Lus10000375 [exp]	9.2	0.8407
AT4G38460		GGR	geranylgeranyl reductase (.1)		Lus10025096 [exp]	9.5	0.8760
AT5G27930			Protein phosphatase 2C family ...		Lus10029874 [exp]	9.7	0.8281
AT3G08690		ATUBC11, UBC11	ubiquitin-conjugating enzyme 1...		Lus10007126 [exp]	9.8	0.8544

Compare expression of checked genes

Lus10035335 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.