Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035339 pacid=23170621 polypeptide=Lus10035339 locus=Lus10035339.g ID=Lus10035339.BGIv1.0 annot-version=v1.0 ATGACACTAACACCCCGCGCCAAACACAGAAGAGAGTCACAGTTGGAGATCATCTTTTTCCAAGAGGAAACGGACGAGAAAGAGCAGAAAGGCAAAGGGG AGACAGAGTTGGGCAGTGCACAAACTTCGAAGGAAAAGCTTTGGGAAGAAGATGGGATGGGTTTTAATTTACTATGA
AA sequence Show only first row Show all	>Lus10035339 pacid=23170621 polypeptide=Lus10035339 locus=Lus10035339.g ID=Lus10035339.BGIv1.0 annot-version=v1.0 MTLTPRAKHRRESQLEIIFFQEETDEKEQKGKGETELGSAQTSKEKLWEEDGMGFNLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035339 [exp]	0	1
AT2G05810			ARM repeat superfamily protein...		Lus10035338 [exp]	5.5	0.7296
AT1G72160			Sec14p-like phosphatidylinosit...		Lus10001539 [exp]	13.7	0.7394
AT4G15930			Dynein light chain type 1 fami...		Lus10037494 [exp]	19.5	0.7274
AT2G05810			ARM repeat superfamily protein...		Lus10035337 [exp]	22.0	0.7105
AT4G00231		MEE50	maternal effect embryo arrest ...		Lus10020777 [exp]	38.7	0.7141
AT1G70280			NHL domain-containing protein ...		Lus10012989 [exp]	50.2	0.7043
AT5G59350			unknown protein		Lus10023421 [exp]	51.6	0.7023
AT3G57400			unknown protein		Lus10018074 [exp]	72.2	0.6924
AT3G51850		CPK13	calcium-dependent protein kina...		Lus10002482 [exp]	78.6	0.6962
AT3G05100			S-adenosyl-L-methionine-depend...		Lus10033850 [exp]	81.2	0.6912

Compare expression of checked genes

Lus10035339 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.