Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63480 190 / 4e-57 ATP binding microtubule motor family protein (.1.2) AT3G19050 116 / 9e-29 POK2 phragmoplast orienting kinesin 2 (.1) AT4G14150 115 / 2e-28 KINESIN-12A, PAKRP1 phragmoplast-associated kinesin-related protein 1 (.1) AT1G12430 114 / 4e-28 AtKINUa, ARK3, PAK phosphatidic acid kinase, Arabidopsis thaliana KINESIN Ungrouped clade, gene A, armadillo repeat kinesin 3 (.1.2) AT3G44050 113 / 8e-28 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G59540 112 / 2e-27 ZCF125 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT3G17360 111 / 3e-27 POK1 phragmoplast orienting kinesin 1 (.1) AT1G01950 110 / 7e-27 AtKINUb, ARK2 Arabidopsis thaliana KINESIN Ungrouped clade, gene B, armadillo repeat kinesin 2 (.1.2.3) AT3G23670 110 / 7e-27 PAKRP1L ,KINESIN-12B phragmoplast-associated kinesin-related protein, putative (.1.2) AT3G54870 110 / 9e-27 AtKINUc, CAE1, ARK1, MRH2 MORPHOGENESIS OF ROOT HAIR 2, CA-ROP2 ENHANCER 1, Arabidopsis thaliana KINESIN Ungrouped clade, gene A, ARMADILLO REPEAT-CONTAINING KINESIN 1, Armadillo/beta-catenin repeat family protein / kinesin motor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029983 [exp] 409 / 1e-140 AT3G63480 466 / 1e-160 ATP binding microtubule motor family protein (.1.2) Lus10009241 [exp] 116 / 6e-29 AT1G01950 1353 / 0.0 Arabidopsis thaliana KINESIN Ungrouped clade, gene B, armadillo repeat kinesin 2 (.1.2.3) Lus10027934 [exp] 115 / 2e-28 AT3G19050 1521 / 0.0 phragmoplast orienting kinesin 2 (.1) Lus10012048 [exp] 115 / 3e-28 AT3G19050 1758 / 0.0 phragmoplast orienting kinesin 2 (.1) Lus10038007 [exp] 114 / 4e-28 AT1G01950 1272 / 0.0 Arabidopsis thaliana KINESIN Ungrouped clade, gene B, armadillo repeat kinesin 2 (.1.2.3) Lus10025708 [exp] 112 / 1e-27 AT2G22610 1238 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Lus10035954 [exp] 112 / 1e-27 AT2G22610 1302 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Lus10038696 [exp] 110 / 1e-26 AT1G01950 966 / 0.0 Arabidopsis thaliana KINESIN Ungrouped clade, gene B, armadillo repeat kinesin 2 (.1.2.3) Lus10008438 [exp] 110 / 1e-26 AT3G44050 1209 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G038900 [exp] 232 / 6e-73 AT3G63480 533 / 0.0 ATP binding microtubule motor family protein (.1.2) Potri.002G149400 [exp] 114 / 5e-28 AT1G01950 1360 / 0.0 Arabidopsis thaliana KINESIN Ungrouped clade, gene B, armadillo repeat kinesin 2 (.1.2.3) Potri.004G193700 [exp] 112 / 2e-27 AT3G44050 1236 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.009G156000 [exp] 112 / 2e-27 AT3G44050 1231 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.002G110600 [exp] 111 / 3e-27 AT2G22610 1057 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2) Potri.003G117000 [exp] 110 / 6e-27 AT1G12430 1348 / 0.0 phosphatidic acid kinase, Arabidopsis thaliana KINESIN Ungrouped clade, gene A, armadillo repeat kinesin 3 (.1.2) Potri.014G070900 [exp] 110 / 9e-27 AT1G01950 1359 / 0.0 Arabidopsis thaliana KINESIN Ungrouped clade, gene B, armadillo repeat kinesin 2 (.1.2.3) Potri.001G115100 [exp] 108 / 2e-26 AT1G12430 1325 / 0.0 phosphatidic acid kinase, Arabidopsis thaliana KINESIN Ungrouped clade, gene A, armadillo repeat kinesin 3 (.1.2) Potri.014G013300 [exp] 108 / 3e-26 AT1G59540 885 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.004G145800 [exp] 108 / 4e-26 AT3G19050 1765 / 0.0 phragmoplast orienting kinesin 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00225 [flax] [poplar] Kinesin Kinesin motor domain
Representative CDS sequence Show only first row Show all	>Lus10035344 pacid=23170624 polypeptide=Lus10035344 locus=Lus10035344.g ID=Lus10035344.BGIv1.0 annot-version=v1.0 ATGAACCTGTCCAGCAGCCGAAGTCATTGTGCGTATATCTTCACAGTCCAACAAGAGCTGACTAGAGAGAGGACACGAACTGGAAAACTGGTCCTTGTTG ACCTAGCAGGATCTGAGAAGGTAGAGAAAACAGGAGCTGAAGGGAAACTTCTTGAAGAAGCCAAAACCATTAACAAATCTCTATCAGCTTTAGGCAACGT GATAAATGCTCTGACATGCAGCTCATCCAAACCCAGTCACATACCTTATCGTGACTCGAAGCTGACTAGGCTTCTCCAAGATGCTCTGGGAGGCAACTCT AGGACTGCTTTAATCTGTTGCTGCTCCCCTAGTTCTTCAAACTCTTCAGAAACATTCTCCACTCTTCGTTTTGGGCGAAATATATCAAGACATCACCTCT CGTCAAGCAAATCATCGAAAACGAGGAGACTTATTCTACCTATGAAGAAGACATCACCTACTTTGACACATACTGATGAGGTTGGATCTCAAGTCCCCAA GAAAGATGAATGCCGTGAAAGAATCCTAGCTAAGCTGAGCGAGAGATTGGACGAAGAGGAAATCAACTTACTCGAGGAGATACTCGTACTGGAAGGGATA CTGTTTGATCCAAGCACAGCTTTAGATTCGGAGTCCGAGTTAGAAGACATAACTATGCGTACAATTTCCTTGCTGCAGCAGAGTCTACAAGAGCTTGTGA TTACTTGCGAAGAGCTAAAGAGTGAGAACAAGGCTCTGAAAGCTAGAATTGCAGCTGGTAAACTTATGGATGATGGAGAGGAAGACGCCAAGGGAAATGG AAGAAGCTTGGTGCAGAAAGTTGCAGGGAGTTTCAGCTTCTTGTTTCGATCGATTCGGTCTGAGCCAGTCAAATCTGTGGAGTAA
AA sequence Show only first row Show all	>Lus10035344 pacid=23170624 polypeptide=Lus10035344 locus=Lus10035344.g ID=Lus10035344.BGIv1.0 annot-version=v1.0 MNLSSSRSHCAYIFTVQQELTRERTRTGKLVLVDLAGSEKVEKTGAEGKLLEEAKTINKSLSALGNVINALTCSSSKPSHIPYRDSKLTRLLQDALGGNS RTALICCCSPSSSNSSETFSTLRFGRNISRHHLSSSKSSKTRRLILPMKKTSPTLTHTDEVGSQVPKKDECRERILAKLSERLDEEEINLLEEILVLEGI LFDPSTALDSESELEDITMRTISLLQQSLQELVITCEELKSENKALKARIAAGKLMDDGEEDAKGNGRSLVQKVAGSFSFLFRSIRSEPVKSVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G63480			ATP binding microtubule motor ...		Lus10035344 [exp]	0	1
AT1G79890			RAD3-like DNA-binding helicase...		Lus10037548 [exp]	2.4	0.9451
AT2G42840		PDF1	protodermal factor 1 (.1)		Lus10007352 [exp]	4.7	0.9485
AT3G29575		AFP3	ABI five binding protein 3 (.1...		Lus10003145 [exp]	7.0	0.8876
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Lus10040333 [exp]	8.8	0.9402
AT5G53390			O-acyltransferase (WSD1-like) ...		Lus10002836 [exp]	9.2	0.8599
AT3G26660	AS2	LBD24	LOB domain-containing protein ...		Lus10009567 [exp]	10.6	0.9317
AT3G63480			ATP binding microtubule motor ...		Lus10035343 [exp]	11.8	0.9299
AT3G54200			Late embryogenesis abundant (L...		Lus10018361 [exp]	12.8	0.8979
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10042835 [exp]	13.4	0.8886
AT5G27240			DNAJ heat shock N-terminal dom...		Lus10036769 [exp]	14.4	0.9239

Compare expression of checked genes

Lus10035344 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.