Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G57540 166 / 7e-55 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029982 [exp] 202 / 2e-69 AT1G57540 164 / 2e-54 unknown protein Lus10024000 [exp] 75 / 9e-18 AT1G57540 62 / 2e-12 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002900 [exp] 166 / 4e-55 AT1G57540 162 / 1e-53 unknown protein Potri.013G002301 [exp] 70 / 1e-17 AT1G57540 63 / 3e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035345 pacid=23170520 polypeptide=Lus10035345 locus=Lus10035345.g ID=Lus10035345.BGIv1.0 annot-version=v1.0 ATGTCGTTGAGACAATACTTGGGGTACTCAGAGGGAGAGCTGATGAGGTCGGACTGCAAGCCGTGTTCAAGGCTTATGAGGCATACAGCTGGGATCTTCA CCGTCGGCGGGGCTTTCGGGTTCTGGATTCTCTGCAGGCTTCATTATGGTCCTAGAGTTACCACACCGAGGGCACTAAGGTGGGCGGCTACTGGAGCTTT GACGGTGAGCTCGTCGACGGCGTTGCTGGTCCGGATGTTTAGCCCAGAGTGCGAGCCACAGAACATTGCTGCTTTTGACAAGCCTATGTCGCCCTAG
AA sequence Show only first row Show all	>Lus10035345 pacid=23170520 polypeptide=Lus10035345 locus=Lus10035345.g ID=Lus10035345.BGIv1.0 annot-version=v1.0 MSLRQYLGYSEGELMRSDCKPCSRLMRHTAGIFTVGGAFGFWILCRLHYGPRVTTPRALRWAATGALTVSSSTALLVRMFSPECEPQNIAAFDKPMSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G57540			unknown protein		Lus10035345 [exp]	0	1
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Lus10031534 [exp]	2.4	0.8882
AT3G02080			Ribosomal protein S19e family ...		Lus10032992 [exp]	8.0	0.8903
AT5G25500			unknown protein		Lus10002897 [exp]	9.4	0.8789
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10022881 [exp]	10.9	0.8892
AT1G63270		ABCI1, ATNAP10	ATP-binding cassette I1, non-i...		Lus10022692 [exp]	16.5	0.8589
AT2G01640			unknown protein		Lus10002816 [exp]	21.4	0.8429
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10011773 [exp]	21.7	0.8725
AT1G31817		NFD3	NUCLEAR FUSION DEFECTIVE 3, Ri...		Lus10007591 [exp]	22.0	0.8082
AT1G69210			Uncharacterised protein family...		Lus10026674 [exp]	25.1	0.8152
AT5G47320		RPS19	ribosomal protein S19 (.1)		Lus10027711 [exp]	26.4	0.8479

Compare expression of checked genes

Lus10035345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.