Lus10035362 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032432 119 / 2e-33 AT1G69630 76 / 1e-14 F-box/RNI-like superfamily protein (.1)
Lus10014140 100 / 9e-29 ND 36 / 0.002
Lus10029587 103 / 1e-27 AT5G02930 74 / 3e-14 F-box/RNI-like superfamily protein (.1)
Lus10023039 99 / 7e-27 AT1G60400 59 / 4e-10 F-box/RNI-like superfamily protein (.1)
Lus10029586 99 / 8e-26 AT3G18150 78 / 2e-15 RNI-like superfamily protein (.1)
Lus10032433 88 / 4e-22 ND 50 / 6e-08
Lus10006318 84 / 2e-20 AT1G69630 74 / 9e-14 F-box/RNI-like superfamily protein (.1)
Lus10029589 83 / 5e-20 AT5G02930 71 / 5e-13 F-box/RNI-like superfamily protein (.1)
Lus10023042 80 / 3e-19 AT1G69630 61 / 4e-10 F-box/RNI-like superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10035362 pacid=23170546 polypeptide=Lus10035362 locus=Lus10035362.g ID=Lus10035362.BGIv1.0 annot-version=v1.0
ATGGAGTTCTCAGAGCAAACCCTTACGTCCCTTGTTCATGCTGATATTGGGAACCTGTGGGGGTGTAGTTACGATGAGGATTTTGATATTGACAAACAAC
ATCTGGTCTTCATGCTCCATGGTTTACGTAAGGTGGAATATCTGACGCTATGCAAAGAGATGAGAGAGGCAGTCTGTAGGAAATCCAAGTTTCTAGAGCA
ACAACCTTGTCCGTTTACTAAACTGAAGAAGTTAAAGTTGGTGTTTGACTCCCGCTACGACATCCCTTATAAGGTTATGAATAAATAA
AA sequence
>Lus10035362 pacid=23170546 polypeptide=Lus10035362 locus=Lus10035362.g ID=Lus10035362.BGIv1.0 annot-version=v1.0
MEFSEQTLTSLVHADIGNLWGCSYDEDFDIDKQHLVFMLHGLRKVEYLTLCKEMREAVCRKSKFLEQQPCPFTKLKKLKLVFDSRYDIPYKVMNK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10035362 0 1

Lus10035362 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.