Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01910 44 / 2e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022734 [exp] 130 / 7e-40 AT5G01910 109 / 5e-30 unknown protein Lus10014179 [exp] 118 / 6e-35 AT5G01910 115 / 3e-32 unknown protein Lus10025130 [exp] 71 / 1e-16 AT5G01910 105 / 1e-28 unknown protein Lus10025214 [exp] 69 / 1e-15 AT5G01910 104 / 2e-28 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G109400 [exp] 62 / 3e-13 AT5G01910 96 / 6e-25 unknown protein Potri.016G138300 [exp] 59 / 7e-12 AT5G01910 122 / 2e-35 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035364 pacid=23170515 polypeptide=Lus10035364 locus=Lus10035364.g ID=Lus10035364.BGIv1.0 annot-version=v1.0 ATGGAGACTTTTCGGGCACCATCGGACAAGGACAACGACAAGGAGAACCATCTTCACCCCCCGGTTCGAACAACTCCGATTATCAGTAAGCTGATCCAGC CGATCATCGATCCGTCGCTGGAGGAGGAGCTGAGTGCGATGCGGAAGAGGATGGAGAGGCTGAGATTGGACGGAGAGAAAACGGAGAAGATGCTTCAGGA AAGGAAAGGTGTTGGATTTGCAGATGAAGGAGCTCAAGATTGGAGGAGAAGCTCAGATGATGATGGAGCTTGA
AA sequence Show only first row Show all	>Lus10035364 pacid=23170515 polypeptide=Lus10035364 locus=Lus10035364.g ID=Lus10035364.BGIv1.0 annot-version=v1.0 METFRAPSDKDNDKENHLHPPVRTTPIISKLIQPIIDPSLEEELSAMRKRMERLRLDGEKTEKMLQERKGVGFADEGAQDWRRSSDDDGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01910			unknown protein		Lus10035364 [exp]	0	1
AT1G49480	B3	REM19, RTV1	related to vernalization1 1 (....		Lus10009214 [exp]	1.0	0.8727
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10006596 [exp]	6.0	0.8233
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	8.5	0.8124
AT5G23200			unknown protein		Lus10017393 [exp]	9.2	0.7508
AT2G20020		CAF1, ATCAF1	RNA-binding CRS1 / YhbY (CRM) ...		Lus10034952 [exp]	9.6	0.8016
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10041961 [exp]	11.3	0.7648
AT5G51010			Rubredoxin-like superfamily pr...		Lus10027889 [exp]	13.7	0.7658
AT5G66550			Maf-like protein (.1)		Lus10040204 [exp]	15.9	0.7664
AT5G04780			Pentatricopeptide repeat (PPR)...		Lus10021649 [exp]	17.2	0.7595
AT3G01460		MBD9, ATMBD9	methyl-CPG-binding domain 9 (....		Lus10030624 [exp]	20.3	0.7312

Compare expression of checked genes

Lus10035364 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.