Lus10035374 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32470 254 / 5e-88 Single hybrid motif superfamily protein (.1)
AT2G35370 249 / 6e-86 GDCH glycine decarboxylase complex H (.1)
AT2G35120 197 / 1e-65 Single hybrid motif superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030979 331 / 2e-118 AT1G32470 254 / 4e-88 Single hybrid motif superfamily protein (.1)
Lus10018319 190 / 1e-62 AT2G35120 244 / 2e-84 Single hybrid motif superfamily protein (.1)
Lus10017133 122 / 3e-36 AT2G35120 162 / 1e-52 Single hybrid motif superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G089300 260 / 2e-90 AT1G32470 260 / 3e-90 Single hybrid motif superfamily protein (.1)
Potri.001G144800 260 / 2e-90 AT1G32470 255 / 3e-88 Single hybrid motif superfamily protein (.1)
Potri.015G122500 191 / 5e-63 AT2G35120 224 / 2e-76 Single hybrid motif superfamily protein (.1)
Potri.012G123700 190 / 1e-62 AT2G35120 217 / 2e-73 Single hybrid motif superfamily protein (.1)
Potri.002G018100 40 / 0.0002 AT1G75980 275 / 8e-95 Single hybrid motif superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0105 Hybrid PF01597 GCV_H Glycine cleavage H-protein
Representative CDS sequence
>Lus10035374 pacid=23170642 polypeptide=Lus10035374 locus=Lus10035374.g ID=Lus10035374.BGIv1.0 annot-version=v1.0
ATGGCGCTAAGAATATGGGCATCTTCAACTGCTAATGCTTTGGGACTCTCAGTTGCCTCCAAAGCTCCTGCTTTCTCTTCCCTCTCCAGATGCTTCTCCA
CTGTAATGGATGGAGTTAAGTACGCAAAGTCACACGAGTGGGTGAAGCATGATGGTTCTGTGGCTCTTGTTGGCATCACCGATCACGCTCAGGATCATCT
TGGGGAAGTGGTGTTCGTGGAGTTGCCGGAGAGTGGGAGCTCAGTGAGCCAAGGAGGAAGCTTTGCTAACATTGAGAGTGTTAAAGCTACCAGTGATGTC
AACTCCCCAATTTCAGGGGACATTGTTGAAGTTAACACCAAGCTCACTGAAACCCCAGGACTGGTGAATTCAAGCCCATATGAAGATGGGTGGATGATAA
AGGTGAAGCCAAGCAACCCAGCAGAGTTGGAGAGCTTGATGGGTCCAACCGAATACACCAAATTCTGTGATGAAGAAGATGCTGCTCATTGA
AA sequence
>Lus10035374 pacid=23170642 polypeptide=Lus10035374 locus=Lus10035374.g ID=Lus10035374.BGIv1.0 annot-version=v1.0
MALRIWASSTANALGLSVASKAPAFSSLSRCFSTVMDGVKYAKSHEWVKHDGSVALVGITDHAQDHLGEVVFVELPESGSSVSQGGSFANIESVKATSDV
NSPISGDIVEVNTKLTETPGLVNSSPYEDGWMIKVKPSNPAELESLMGPTEYTKFCDEEDAAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G32470 Single hybrid motif superfamil... Lus10035374 0 1
AT1G32470 Single hybrid motif superfamil... Lus10030979 1.0 0.9927
AT2G26500 cytochrome b6f complex subunit... Lus10011665 2.0 0.9594
AT5G27560 Domain of unknown function (DU... Lus10029915 2.4 0.9540
AT4G37925 NdhM, NDH-M NADH dehydrogenase-like comple... Lus10042759 4.0 0.9364
AT4G24750 Rhodanese/Cell cycle control p... Lus10043306 4.5 0.9480
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10026006 6.0 0.9538
AT1G18170 FKBP-like peptidyl-prolyl cis-... Lus10027246 7.7 0.9444
AT1G54500 Rubredoxin-like superfamily pr... Lus10015945 8.4 0.9428
AT3G16250 PnsB3, NDF4 Photosynthetic NDH subcomplex... Lus10025809 11.2 0.9411
AT3G15360 ATHM4, ATM4, TR... ARABIDOPSIS THIOREDOXIN M-TYPE... Lus10029752 11.5 0.9383

Lus10035374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.