Lus10035378 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10035378 pacid=23170577 polypeptide=Lus10035378 locus=Lus10035378.g ID=Lus10035378.BGIv1.0 annot-version=v1.0
ATGCAGGTCAGCAATGTGCGACCTGCCCAACGGCATAATTGGTTCTTGGGGTTGCAGAGTTCTCTGCTCGGCTCCAGCAACATCTCGACCATGATCGGTT
ACCCACTGTCTCCTAACTTCGTCCGCCGTCGCTCTCCAAAGCAAATCAACAGTCTGTCTAGTCGTCGGAAGAATCGAGAGTCTTCTGTACTGAGCCGAAG
GAATTTCCGAATTTCAGACTTTGGTTCTGCCTCCGCGATCGCCATCTGTTTCCTGACAGCGCAGAAGGTGCGGAGGTTTCTAAGTCCAGGAAACGATCTG
AAGATCGGTAAGATGCCGACATGTCCAAGTATTAGGAACAAGAACCTGCAAAAGGTGCGGAGCTCTGTGGAACAGGGCGAGGAAGTCAAGGATGGAGAGA
AGGAGGAGCGGTGA
AA sequence
>Lus10035378 pacid=23170577 polypeptide=Lus10035378 locus=Lus10035378.g ID=Lus10035378.BGIv1.0 annot-version=v1.0
MQVSNVRPAQRHNWFLGLQSSLLGSSNISTMIGYPLSPNFVRRRSPKQINSLSSRRKNRESSVLSRRNFRISDFGSASAIAICFLTAQKVRRFLSPGNDL
KIGKMPTCPSIRNKNLQKVRSSVEQGEEVKDGEKEER

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10035378 0 1
AT1G12390 Cornichon family protein (.1) Lus10009295 10.1 0.7866
AT5G04910 unknown protein Lus10008941 10.3 0.7938
AT3G19460 Reticulon family protein (.1.2... Lus10019812 28.2 0.7865
AT4G31720 STG1, TAFII15, ... TBP-ASSOCIATED FACTOR 10, SALT... Lus10005077 28.8 0.7776
AT2G41760 unknown protein Lus10007544 30.7 0.7543
AT1G12400 Nucleotide excision repair, TF... Lus10006998 35.2 0.7845
AT2G04900 unknown protein Lus10001166 42.3 0.7676
AT5G64350 FKP12, ATFKBP12... ARABIDOPSIS THALIANA FK506-BIN... Lus10003760 42.4 0.7510
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10031022 46.7 0.7516
AT5G39950 ATTRXH2, ATTRX2... Arabidopsis thioredoxin h2, th... Lus10005258 50.7 0.7674

Lus10035378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.