Lus10035381 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G74340 119 / 6e-37 DPMS2, DPMS dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030984 140 / 1e-45 AT1G74340 120 / 2e-37 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G138100 120 / 1e-37 AT1G74340 124 / 3e-39 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
Potri.003G095701 39 / 1e-05 AT1G74340 37 / 6e-05 dolichol phosphate mannose synthase 2, dolichol phosphate-mannose biosynthesis regulatory protein-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07297 DPM2 Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)
Representative CDS sequence
>Lus10035381 pacid=23170661 polypeptide=Lus10035381 locus=Lus10035381.g ID=Lus10035381.BGIv1.0 annot-version=v1.0
ATGGAATTAGCAGACAGAGCAGTTGGATTACTCTTGTCAATAGTCAGCTTATCGATCTTCACATATTATACCTTCTGGGTTATTATCCTGCCGTTTGTAG
ACCATGATCACTTCATTCACCAATATTTCCTGCCACTGGAGTATGCCATATTCATACCCGTATTTGCTGGTGTCGCCCTTGTTTGCTTATTGTCTCTGTT
TGTTGGGTCTGTCATGCTCAAGTCCAAGAAGAAGAAGGCCTGA
AA sequence
>Lus10035381 pacid=23170661 polypeptide=Lus10035381 locus=Lus10035381.g ID=Lus10035381.BGIv1.0 annot-version=v1.0
MELADRAVGLLLSIVSLSIFTYYTFWVIILPFVDHDHFIHQYFLPLEYAIFIPVFAGVALVCLLSLFVGSVMLKSKKKKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G74340 DPMS2, DPMS dolichol phosphate mannose syn... Lus10035381 0 1
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10032281 9.5 0.6557
AT1G05430 unknown protein Lus10006108 17.6 0.6493
AT1G77580 Plant protein of unknown funct... Lus10018164 29.1 0.6062
AT4G09550 ATGIP1 ARABIDOPSIS ATGCP3 INTERACTING... Lus10018288 30.6 0.5816
AT2G44525 Protein of unknown function (D... Lus10007558 35.7 0.5569
AT1G11000 ATMLO4, MLO4 MILDEW RESISTANCE LOCUS O 4, S... Lus10012698 36.3 0.5753
AT2G21250 NAD(P)-linked oxidoreductase s... Lus10018058 44.6 0.5855
AT1G02100 SBI1 SUPPRESSOR OF BRI1, Leucine ca... Lus10042909 58.4 0.4952
AT4G12490 Bifunctional inhibitor/lipid-t... Lus10024619 66.2 0.5211
AT2G13690 PRLI-interacting factor, putat... Lus10033484 85.5 0.5057

Lus10035381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.