Lus10035384 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G35490 337 / 3e-114 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G22240 231 / 5e-74 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G04020 231 / 1e-73 FIB fibrillin (.1)
AT5G09820 52 / 2e-07 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
AT2G46910 48 / 5e-06 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G26070 45 / 2e-05 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT2G42130 44 / 7e-05 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030987 587 / 0 AT2G35490 354 / 5e-121 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10001099 219 / 7e-69 AT4G22240 362 / 5e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10014790 218 / 2e-68 AT4G22240 363 / 2e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10020982 57 / 6e-09 AT3G26070 265 / 1e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10033514 56 / 6e-09 AT5G09820 270 / 3e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10020860 56 / 6e-09 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10036340 53 / 1e-07 AT2G46910 325 / 6e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10004171 49 / 1e-06 AT2G42130 378 / 3e-133 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Lus10012003 49 / 2e-06 AT2G42130 383 / 3e-134 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G137900 360 / 3e-123 AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G095900 352 / 2e-120 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.004G003200 228 / 2e-72 AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G209600 60 / 3e-10 AT3G26070 253 / 7e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G020700 56 / 1e-08 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G309300 52 / 2e-07 AT5G09820 268 / 7e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04755 PAP_fibrillin PAP_fibrillin
Representative CDS sequence
>Lus10035384 pacid=23170539 polypeptide=Lus10035384 locus=Lus10035384.g ID=Lus10035384.BGIv1.0 annot-version=v1.0
ATGGCCCTTCTCTCCACAGCTCACACTTCCCCCTTCTTCACCAAAACCCCCAATTCCATATCTCCAGTTTCCACTCACAAACCCCCACCTTCCACCCTCT
TCTTCCCCAGAAACCCTAACCAGTCTTCCCGATTCACATCCCTTCTTCCCCGCTCCTCACCTTCCGATTCCAATCCGAAACCCGACAAGAAGCCTACCCC
GGTCACCGATGAGTGGGGCGAGAAGTCAGAAACCGAGCCCGAAAGGCTCAAGGGCGCCGCGTCGGATCCTCCGCTGAACGAGGATGAGTGGGAGGTGAAG
GACGAGGAGGCTTACCCCGCCGGAGCAGGAAATGGAACTCCTTCTCCGGCCGCTGCAGCCGCAACTGAAGAAGAGAAGAAAAACAAGGACGAAGCTATCG
AGGAGCTGAAGAGGAGTTTGGCGGACACTGTTTACGGCACGGATTTTGGGTTCCGGGCCGGCTCCGAGGTCCGAGCTGAAGTATCCGAGTTGGTCAACCA
GTTGGAGGCTGCGAATCCTACTCCTGCTCCTGTTGACGCCACCCTGTTGCTCGATGGGAACTGGATTTTGCTGTACACCGCATCTTCGGAGCTTCTGCCG
CTTCTAGCAGTTGGAGGAACATCGCCTTTGTTGAAGGTGAAAAAGATAACTCAATCAATCAACACCAGCAGTGCCACCATTGTGAACTCGACCACATTGT
CGAGTCCGTTTGCTGATTTCTCATTCAGCGCAACTGCTAATTTTGAAGTCAGAAGTCCTTCTAGAATACAGGTTGAATTCAAAGAGGGAACTCTGCAGCC
TCCAGATGTGAAATCCAGCATCGATCTTCCGGACGAAGTAACTTTATTTGGCCAGAAGATCAGCCTGTCGCCTGTTCGTCAATCCCTCAGTCCTCTGCAA
CAGCCGGTGGAGGCTATCTCGAGAGCCATTTCAGGGCAGTCGCCCCTTACAGTTCCGATTCCGGGTGGTCGATCAAGCTCATGGCTTATAACTACCTACC
TCGATGAGGATCTTCGGATTTCGAGAGGTGATGGCGGTCTCTTCATACTTGCCAAGGAAGGCAGCCCTCTTTTGTTTCAGTAA
AA sequence
>Lus10035384 pacid=23170539 polypeptide=Lus10035384 locus=Lus10035384.g ID=Lus10035384.BGIv1.0 annot-version=v1.0
MALLSTAHTSPFFTKTPNSISPVSTHKPPPSTLFFPRNPNQSSRFTSLLPRSSPSDSNPKPDKKPTPVTDEWGEKSETEPERLKGAASDPPLNEDEWEVK
DEEAYPAGAGNGTPSPAAAAATEEEKKNKDEAIEELKRSLADTVYGTDFGFRAGSEVRAEVSELVNQLEAANPTPAPVDATLLLDGNWILLYTASSELLP
LLAVGGTSPLLKVKKITQSINTSSATIVNSTTLSSPFADFSFSATANFEVRSPSRIQVEFKEGTLQPPDVKSSIDLPDEVTLFGQKISLSPVRQSLSPLQ
QPVEAISRAISGQSPLTVPIPGGRSSSWLITTYLDEDLRISRGDGGLFILAKEGSPLLFQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G35490 Plastid-lipid associated prote... Lus10035384 0 1
AT3G16520 UGT88A1 UDP-glucosyl transferase 88A1 ... Lus10039301 1.0 0.9428
AT4G00895 ATPase, F1 complex, OSCP/delta... Lus10012618 3.5 0.9293
AT5G03555 permease, cytosine/purines, ur... Lus10014397 4.0 0.9259
AT2G46735 unknown protein Lus10002690 4.2 0.9268
AT1G32900 GBSS1 granule bound starch synthase ... Lus10033245 5.3 0.9046
AT1G53670 MSRB1, ATMSRB1 methionine sulfoxide reductase... Lus10013727 8.7 0.9167
AT2G35490 Plastid-lipid associated prote... Lus10030987 10.4 0.9017
AT1G02800 ATCEL2 cellulase 2 (.1) Lus10017338 13.6 0.9155
AT5G52450 MATE efflux family protein (.1... Lus10029668 16.1 0.9001
AT4G32480 Protein of unknown function (D... Lus10041046 17.3 0.8901

Lus10035384 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.