Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45940 39 / 0.0003 Glycosyl hydrolases family 31 protein (.1) AT1G68560 38 / 0.0007 AXY3, TRG1, XYL1, ATXYL1 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031003 [exp] 162 / 4e-47 AT3G45940 97 / 3e-20 Glycosyl hydrolases family 31 protein (.1) Lus10008067 [exp] 41 / 0.0001 AT5G11720 1072 / 0.0 Glycosyl hydrolases family 31 protein (.1) Lus10041457 [exp] 40 / 0.0002 AT1G68560 1455 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Lus10035020 [exp] 40 / 0.0003 AT1G68560 1238 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Lus10038408 [exp] 39 / 0.0004 AT5G11720 1150 / 0.0 Glycosyl hydrolases family 31 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G039500 [exp] 106 / 1e-27 AT5G63840 74 / 3e-13 RADIAL SWELLING 3, PRIORITY IN SWEET LIFE 5, Glycosyl hydrolases family 31 protein (.1) Potri.011G154500 [exp] 40 / 0.0001 AT5G11720 1215 / 0.0 Glycosyl hydrolases family 31 protein (.1) Potri.011G154300 [exp] 40 / 0.0001 AT5G11720 1194 / 0.0 Glycosyl hydrolases family 31 protein (.1) Potri.008G120000 [exp] 39 / 0.0003 AT1G68560 1465 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1) Potri.001G442800 [exp] 39 / 0.0003 AT5G11720 1167 / 0.0 Glycosyl hydrolases family 31 protein (.1) Potri.010G125800 [exp] 39 / 0.0004 AT1G68560 1422 / 0.0 thermoinhibition resistant germination 1, altered xyloglucan 3, alpha-xylosidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF01055 [flax] [poplar] Glyco_hydro_31 Glycosyl hydrolases family 31
Representative CDS sequence Show only first row Show all	>Lus10035399 pacid=23170596 polypeptide=Lus10035399 locus=Lus10035399.g ID=Lus10035399.BGIv1.0 annot-version=v1.0 ATGATTGGAGTGGAACTTCTGGGAGTGACAACCATTTCAGTGACGTTTAGATCTCGATCGGAGGCTCTGATACCATTTCAGATGAGCTCAATCGAGCGAG AGGGAGGGAGGAAGGAAGAAAGAGAAGCGTCAGAGAAAGGGCTGCCGATATGCCGACACATGGTCCTCCACTACCCGAGCGACAAGACCGTGGGGAAGCT TAGCTACGAGCAGTTCCTGGTCGGAACAGAGATCCTGGTGGTGCCTGTTTTGGATAAAGAGAAACAGGAAGTGAAGGCCTATTTCCCAAAGGCTGATCAA CGTTTTTCGACATCCTCTTCTTGGTTGCATGTTTGGTCGGGGAAAGTGTATGATGAAGTGGGTTGTGATGCTTTGGTTTAA
AA sequence Show only first row Show all	>Lus10035399 pacid=23170596 polypeptide=Lus10035399 locus=Lus10035399.g ID=Lus10035399.BGIv1.0 annot-version=v1.0 MIGVELLGVTTISVTFRSRSEALIPFQMSSIEREGGRKEEREASEKGLPICRHMVLHYPSDKTVGKLSYEQFLVGTEILVVPVLDKEKQEVKAYFPKADQ RFSTSSSWLHVWSGKVYDEVGCDALV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035399 [exp]	0	1

Compare expression of checked genes

Lus10035399 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.