Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031014 [exp] 56 / 2e-12 ND 41 / 2e-06
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035412 pacid=23170680 polypeptide=Lus10035412 locus=Lus10035412.g ID=Lus10035412.BGIv1.0 annot-version=v1.0 ATGGCAGATAATAGCAGAGCCAACAGGGTAGAAGAGAATCAGCAGCCAACTCCACCAGGGTACCCAACAGAGAATCAGGTTGCTCACCCTACTGGGAAGA AGTTCATCCCCAAAACAAAGAAGAAAGGAGACAGAGGCTTCATAGAAGGATGGTAA
AA sequence Show only first row Show all	>Lus10035412 pacid=23170680 polypeptide=Lus10035412 locus=Lus10035412.g ID=Lus10035412.BGIv1.0 annot-version=v1.0 MADNSRANRVEENQQPTPPGYPTENQVAHPTGKKFIPKTKKKGDRGFIEGW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035412 [exp]	0	1
					Lus10031014 [exp]	1.0	0.9330
AT3G25855			Copper transport protein famil...		Lus10035027 [exp]	5.8	0.9090
AT5G05365			Heavy metal transport/detoxifi...		Lus10009848 [exp]	7.7	0.8817
AT1G60890			Phosphatidylinositol-4-phospha...		Lus10015456 [exp]	7.7	0.8749
AT5G42470			unknown protein		Lus10034533 [exp]	7.9	0.8135
AT5G05570			transducin family protein / WD...		Lus10027810 [exp]	13.9	0.8949
					Lus10036407 [exp]	14.9	0.8065
AT4G35000		APX3	ascorbate peroxidase 3 (.1)		Lus10000180 [exp]	15.1	0.8956
AT5G01750			Protein of unknown function (D...		Lus10009093 [exp]	17.4	0.8598
AT3G27027			Protein of unknown function (D...		Lus10032029 [exp]	18.7	0.7828

Compare expression of checked genes

Lus10035412 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.