Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031022 [exp] 96 / 7e-25 AT3G19184 96 / 4e-22 AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035415 pacid=23170665 polypeptide=Lus10035415 locus=Lus10035415.g ID=Lus10035415.BGIv1.0 annot-version=v1.0 ATGGGGGCAGCTGTGAAGAGTGAAATGGAAGACGGAGATTCCAGCAGAGCTTCCCCGATAACGCATGCTGACTTCAAATCTGCTGGTGAAGACGACGCTG CTACCCTTGCTCGATTCTCTCTCTCTCCTGATACTACTGACGCTAACCCCAACACCGACCTTGCTGCTTCGCTCTCGGCTCAGATGAACAATCAGATCGA GAAGAGGCAGAGACGTTTGAAGATCAAACTCTCTTGTTGTCATTCCAAACTTGATCATGTAAGAGTTGCTTAA
AA sequence Show only first row Show all	>Lus10035415 pacid=23170665 polypeptide=Lus10035415 locus=Lus10035415.g ID=Lus10035415.BGIv1.0 annot-version=v1.0 MGAAVKSEMEDGDSSRASPITHADFKSAGEDDAATLARFSLSPDTTDANPNTDLAASLSAQMNNQIEKRQRRLKIKLSCCHSKLDHVRVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035415 [exp]	0	1
AT5G46190			RNA-binding KH domain-containi...		Lus10038509 [exp]	16.8	0.6433
AT5G08120		MPB2C, ATMBP2C,...	movement protein binding prote...		Lus10034653 [exp]	37.5	0.6253
AT1G32090			early-responsive to dehydratio...		Lus10002133 [exp]	43.2	0.6123
AT1G48310		CHR18, CHA18	chromatin remodeling factor18 ...		Lus10006642 [exp]	44.6	0.5373
AT3G60050			Pentatricopeptide repeat (PPR)...		Lus10039221 [exp]	62.6	0.5649
AT2G01730		ATCPSF73-II, ED...	embryo sac development arrest ...		Lus10035763 [exp]	89.3	0.5582
AT1G59640	bHLH	ZCW32, bHLH031...	BIG PETAL UB, BIG PETAL P (.1....		Lus10030807 [exp]	95.5	0.5495
AT1G68810	bHLH	bHLH030	basic helix-loop-helix (bHLH) ...		Lus10035056 [exp]	111.9	0.5230
AT1G76190			SAUR-like auxin-responsive pro...		Lus10021825 [exp]	123.2	0.5325

Compare expression of checked genes

Lus10035415 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.