Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41430 114 / 3e-33 LSR1, CID1, ERD15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) AT4G14270 70 / 2e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031029 [exp] 224 / 2e-77 AT2G41430 115 / 3e-34 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10018018 [exp] 164 / 3e-53 AT2G41430 102 / 8e-29 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10042014 [exp] 162 / 2e-52 AT2G41430 99 / 1e-27 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10019769 [exp] 92 / 8e-25 AT2G41430 91 / 1e-23 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10016358 [exp] 91 / 7e-24 AT2G41430 83 / 1e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10040964 [exp] 71 / 2e-16 AT2G41430 69 / 2e-15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Lus10009847 [exp] 61 / 1e-12 AT2G41430 63 / 3e-13 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G044600 [exp] 162 / 2e-52 AT2G41430 122 / 3e-36 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Potri.016G041600 [exp] 154 / 3e-49 AT2G41430 121 / 1e-35 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Potri.001G023100 [exp] 108 / 5e-31 AT4G14270 89 / 3e-23 unknown protein Potri.003G202500 [exp] 93 / 8e-25 AT2G41430 81 / 5e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5) Potri.010G182800 [exp] 69 / 6e-16 AT4G14270 65 / 6e-14 unknown protein Potri.008G074600 [exp] 68 / 2e-15 AT4G14270 66 / 2e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035419 pacid=23170654 polypeptide=Lus10035419 locus=Lus10035419.g ID=Lus10035419.BGIv1.0 annot-version=v1.0 ATGGCACTAGTATCGGGAGGAAGGTCGACACTAAACCCAGACGCCCCACTCTTCATCCCAGCTGCATACAGGCAAGTAGAGGACTTCTCCCCTGAGTGGT GGCAGCTGGTCACCACCACAGCATGGTACAAGGACTACTGGCTAACGGAGCATCAGAACGAGGAAGGCTTCTACAACAACGCTGAGAAAGATGATGGTAG CTTCGACACCAAGGATGTAGCTGCCCTGTTGCCAGACTCTTTCGATCTCGAAGTTGGTGAAGACTTCTCTTCCCTTGAAGCTCAGTTTGAGGAGTTTGAC GAGTCTTATGAACCCCAAACTGTTCCCTCCTATGCAAATCGTAACCGTAATGTTCAACCATTCGATTAG
AA sequence Show only first row Show all	>Lus10035419 pacid=23170654 polypeptide=Lus10035419 locus=Lus10035419.g ID=Lus10035419.BGIv1.0 annot-version=v1.0 MALVSGGRSTLNPDAPLFIPAAYRQVEDFSPEWWQLVTTTAWYKDYWLTEHQNEEGFYNNAEKDDGSFDTKDVAALLPDSFDLEVGEDFSSLEAQFEEFD ESYEPQTVPSYANRNRNVQPFD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41430		LSR1, CID1, ERD...	CTC-Interacting Domain 1, dehy...		Lus10035419 [exp]	0	1
AT1G78680		ATGGH2	gamma-glutamyl hydrolase 2 (.1...		Lus10028143 [exp]	1.0	0.8796
AT1G04960			Protein of unknown function (D...		Lus10014626 [exp]	4.0	0.8560
AT1G17030			unknown protein		Lus10024442 [exp]	4.0	0.8403
AT3G21610			Acid phosphatase/vanadium-depe...		Lus10030025 [exp]	4.6	0.8524
AT5G15460		MUB2	membrane-anchored ubiquitin-fo...		Lus10013190 [exp]	4.7	0.8072
AT4G05000		VPS28-2, VPS28-...	vacuolar protein sorting-assoc...		Lus10011243 [exp]	4.9	0.8218
AT5G45110		ATNPR3, NPR3	NPR1-like protein 3 (.1)		Lus10040620 [exp]	8.1	0.8300
AT5G42820	C3HZnF	ATU2AF35B	Zinc finger C-x8-C-x5-C-x3-H t...		Lus10008648 [exp]	8.5	0.7940
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Lus10024638 [exp]	12.0	0.8348
AT1G27770		PEA1, ACA1	PLASTID ENVELOPE ATPASE 1, aut...		Lus10018687 [exp]	14.6	0.7801

Compare expression of checked genes

Lus10035419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.