Lus10035430 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10035430 pacid=23170679 polypeptide=Lus10035430 locus=Lus10035430.g ID=Lus10035430.BGIv1.0 annot-version=v1.0
ATGCCAACTGCCGGCCTCCAAAATATGCCACCTAAAACATCCACCCCGCTCTCCCCATCCACCGCTGCAAGCACCCCCTCTGCTCGCCACACCTCCACTC
CCACACCCGCCCTCACCTCCTTGTCACCCTATTCCCTCTCTACTGTTGGAACTGGCCTCACCAATCGACACCCCTTCACCTCCACCGCTGCCTCCAACAT
CCACCGCCCACCAAGTCCTCTCAACAACCGCCCCACAACATCCACACCGACGCCGTCGGGTTTCACCCCTCGACCGGCGAGTCTGTTGCTGGCCGCCGAT
GGCCAGAGGCCGGAGAGCCCCATGGGGGTAATTTTGGCCCCGCGCAAGCTGTCTCGGAGATTTTGA
AA sequence
>Lus10035430 pacid=23170679 polypeptide=Lus10035430 locus=Lus10035430.g ID=Lus10035430.BGIv1.0 annot-version=v1.0
MPTAGLQNMPPKTSTPLSPSTAASTPSARHTSTPTPALTSLSPYSLSTVGTGLTNRHPFTSTAASNIHRPPSPLNNRPTTSTPTPSGFTPRPASLLLAAD
GQRPESPMGVILAPRKLSRRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10035430 0 1
AT5G43150 unknown protein Lus10041628 1.4 0.8452
AT3G27250 unknown protein Lus10032077 5.7 0.8451
AT1G70000 MYB myb-like transcription factor ... Lus10010733 8.8 0.8441
AT5G04530 KCS19 3-ketoacyl-CoA synthase 19 (.1... Lus10033625 11.7 0.8173
AT1G67600 Acid phosphatase/vanadium-depe... Lus10011373 11.8 0.8352
AT1G03350 BSD domain-containing protein ... Lus10042670 12.6 0.8267
AT3G47420 AtG3Pp1, ATPS3 Glycerol-3-phosphate permease ... Lus10027211 17.9 0.8050
AT3G12800 SDRB, DECR short-chain dehydrogenase-redu... Lus10031170 19.9 0.8048
AT5G49610 F-box family protein (.1) Lus10017086 21.4 0.8025
AT4G11570 Haloacid dehalogenase-like hyd... Lus10035494 21.6 0.7908

Lus10035430 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.