Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018074 [exp] 51 / 1e-08 AT3G57400 290 / 1e-91 unknown protein Lus10042067 [exp] 46 / 9e-07 AT3G57400 107 / 4e-26 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G056300 [exp] 48 / 2e-07 AT3G57400 343 / 5e-113 unknown protein Potri.006G050100 [exp] 47 / 4e-07 AT3G57400 349 / 3e-115 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035449 pacid=23170614 polypeptide=Lus10035449 locus=Lus10035449.g ID=Lus10035449.BGIv1.0 annot-version=v1.0 ATGGCAATTACTCCCAATTCCAAAACAACCTCCTCCCCCTCCTCCGCCGCCACCAACAACCACCGCGGCAATGGCATGGGCTTCTTACTCGTCTTCTTCC CAGAGTCCAAACCCGAACTAGCTATGAAGCGTACCAATTCCAACAATCCAATCCTCACCAAAACTCAATCCACCATCTCAATCTGCGCCTTCTTGTTCCT CTTCTCCTTCCTCCTCTTCGCCCTCTCCAATTTCGAGCCTCCCCCTTCCCCCGTTTCCGTCCCCTTCCCCCGTTTCCTTTACCCCTCGCCGTTTCCTCTC CGAACGCGGAGGTAG
AA sequence Show only first row Show all	>Lus10035449 pacid=23170614 polypeptide=Lus10035449 locus=Lus10035449.g ID=Lus10035449.BGIv1.0 annot-version=v1.0 MAITPNSKTTSSPSSAATNNHRGNGMGFLLVFFPESKPELAMKRTNSNNPILTKTQSTISICAFLFLFSFLLFALSNFEPPPSPVSVPFPRFLYPSPFPL RTRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035449 [exp]	0	1
AT4G33510		DHS2	3-deoxy-d-arabino-heptulosonat...		Lus10001002 [exp]	6.5	0.8002
AT3G02900			unknown protein		Lus10009524 [exp]	36.7	0.7284
AT1G74960		ATKAS2, KAS2, F...	ARABIDOPSIS BETA-KETOACYL-ACP ...		Lus10034886 [exp]	61.6	0.7642
AT4G17300		ATNS1, NS1, OVA...	ovule abortion 8, Class II ami...		Lus10028945 [exp]	78.9	0.7105
AT5G08415			Radical SAM superfamily protei...		Lus10041005 [exp]	97.9	0.6973
AT3G26780		MEF14	mitochondrial editing factor 1...		Lus10031987 [exp]	102.0	0.7467
AT2G40540		ATKUP2, ATKT2, ...	potassium transporter 2 (.1.2)		Lus10030539 [exp]	108.6	0.6988
AT5G02410		ALG10	homolog of yeast ALG10, DIE2/A...		Lus10003973 [exp]	119.0	0.7229
AT1G57610			Protein of unknown function (D...		Lus10019127 [exp]	158.6	0.6885
AT3G58140			phenylalanyl-tRNA synthetase c...		Lus10018853 [exp]	167.3	0.7096

Compare expression of checked genes

Lus10035449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.