Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22250 76 / 1e-17 UDP-Glycosyltransferase superfamily protein (.1) AT5G05870 41 / 2e-05 UGT76C1 UDP-glucosyl transferase 76C1 (.1) AT3G55700 40 / 5e-05 UDP-Glycosyltransferase superfamily protein (.1) AT3G55710 39 / 0.0001 UDP-Glycosyltransferase superfamily protein (.1) AT5G59580 39 / 0.0002 UGT76E1 UDP-glucosyl transferase 76E1 (.1) AT3G46660 38 / 0.0004 UGT76E12 UDP-glucosyl transferase 76E12 (.1) AT3G11340 37 / 0.0005 UGT76B1 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) AT5G38010 37 / 0.0006 UDP-Glycosyltransferase superfamily protein (.1) AT2G30150 37 / 0.0007 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031068 [exp] 166 / 1e-51 AT3G22250 355 / 5e-120 UDP-Glycosyltransferase superfamily protein (.1) Lus10040246 [exp] 46 / 4e-07 AT3G11340 488 / 3e-171 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10004673 [exp] 45 / 7e-07 AT3G11340 236 / 1e-76 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10004671 [exp] 44 / 2e-06 AT3G55700 450 / 4e-156 UDP-Glycosyltransferase superfamily protein (.1) Lus10037268 [exp] 41 / 3e-05 AT3G11340 447 / 1e-154 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10004672 [exp] 41 / 4e-05 AT3G11340 417 / 1e-142 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10032218 [exp] 40 / 4e-05 AT1G22380 564 / 0.0 UDP-glucosyl transferase 85A3 (.1) Lus10035903 [exp] 39 / 0.0001 AT1G22360 522 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Lus10014082 [exp] 39 / 0.0002 AT2G15480 483 / 3e-168 UDP-glucosyl transferase 73B5 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G019400 [exp] 83 / 4e-20 AT3G22250 494 / 3e-173 UDP-Glycosyltransferase superfamily protein (.1) Potri.006G039300 [exp] 42 / 2e-05 AT5G59590 347 / 2e-115 UDP-glucosyl transferase 76E2 (.1) Potri.006G023700 [exp] 41 / 2e-05 AT1G22370 476 / 2e-165 UDP-glucosyl transferase 85A5 (.1.2) Potri.010G195300 [exp] 39 / 0.0001 AT3G11340 485 / 6e-170 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.010G195500 [exp] 39 / 0.0002 AT3G11340 483 / 3e-169 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.016G021100 [exp] 38 / 0.0002 AT1G22360 505 / 5e-177 UDP-glucosyl transferase 85A2 (.1.2) Potri.001G245900 [exp] 38 / 0.0002 AT3G46660 452 / 7e-157 UDP-glucosyl transferase 76E12 (.1) Potri.013G118700 [exp] 37 / 0.0006 AT5G17050 533 / 0.0 UDP-glucosyl transferase 78D2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035452 pacid=23170506 polypeptide=Lus10035452 locus=Lus10035452.g ID=Lus10035452.BGIv1.0 annot-version=v1.0 ATGATTTGCTACCTGATCGCCGGGGATCAATTCGTGAACTGTAAGTATGTCGTTGAGAAGTTGCGGGTTGGAGTGAGGTTGAATGGGTTTAGGAGGTGTG ATGTTGAGGAAGGTCTGAGGAAGATAATGTGTGAGAGTGATGCTGGGAATGAAGAGATGAGTCGTAGGTTGGATAGGTTGTGTGAAATGAGTATGGGTAA GGTAGCTAATCTTAAGAGGATGGCTAATCTCAATAGCTTTGTTGATCTCATTATGAACAAATGTTAA
AA sequence Show only first row Show all	>Lus10035452 pacid=23170506 polypeptide=Lus10035452 locus=Lus10035452.g ID=Lus10035452.BGIv1.0 annot-version=v1.0 MICYLIAGDQFVNCKYVVEKLRVGVRLNGFRRCDVEEGLRKIMCESDAGNEEMSRRLDRLCEMSMGKVANLKRMANLNSFVDLIMNKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22250			UDP-Glycosyltransferase superf...		Lus10035452 [exp]	0	1
AT1G66150		TMK1	transmembrane kinase 1 (.1)		Lus10021795 [exp]	2.0	0.8409
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10000433 [exp]	4.0	0.7917
AT3G06120	bHLH	MUTE, bHLH045	MUTE, basic helix-loop-helix (...		Lus10010503 [exp]	4.2	0.8463
AT1G68260			Thioesterase superfamily prote...		Lus10031948 [exp]	6.9	0.8751
AT3G09870			SAUR-like auxin-responsive pro...		Lus10013819 [exp]	9.2	0.8626
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10028514 [exp]	14.0	0.8332
AT5G39680		EMB2744	EMBRYO DEFECTIVE 2744, Pentatr...		Lus10008483 [exp]	15.0	0.7326
AT2G40435			unknown protein		Lus10010217 [exp]	19.9	0.7774
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10039721 [exp]	22.6	0.7618
					Lus10038619 [exp]	26.9	0.7674

Compare expression of checked genes

Lus10035452 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.