Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05400 108 / 7e-31 copper ion binding (.1.2) AT4G21140 100 / 1e-27 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027072 [exp] 156 / 3e-49 AT4G05400 282 / 2e-96 copper ion binding (.1.2) Lus10008331 [exp] 147 / 1e-45 AT4G05400 269 / 5e-91 copper ion binding (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G098000 [exp] 135 / 2e-41 AT4G05400 273 / 6e-93 copper ion binding (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035454 pacid=23170625 polypeptide=Lus10035454 locus=Lus10035454.g ID=Lus10035454.BGIv1.0 annot-version=v1.0 ATGCTGAAGAAAGGTGGGAGACAGGCGATGGGAGTTCCGGACGAGCCGTTGATGATGGGAACTCCTGGATTCGACCTAATCTCGCTTGGATTGGTGGATG CCGATAAGATTCATAAATACGAGCAGACGGTGGAGGACGGGAGGAGGCTGGCGAAGGAGTACATTAGGGTTTTGATGAGGAAGCACCGGGTGAGGCAGGC GGCCGAGACGAATCTGTTGAGGATGAAGAAGGAAGCGATCGAAGCGTTGCCGGGTTGA
AA sequence Show only first row Show all	>Lus10035454 pacid=23170625 polypeptide=Lus10035454 locus=Lus10035454.g ID=Lus10035454.BGIv1.0 annot-version=v1.0 MLKKGGRQAMGVPDEPLMMGTPGFDLISLGLVDADKIHKYEQTVEDGRRLAKEYIRVLMRKHRVRQAAETNLLRMKKEAIEALPG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G05400			copper ion binding (.1.2)		Lus10035454 [exp]	0	1
AT4G40060	HD	ATHB16 ,ATHB-16	homeobox protein 16 (.1)		Lus10023159 [exp]	1.7	0.8171
AT5G42440			Protein kinase superfamily pro...		Lus10015344 [exp]	5.3	0.8022
AT3G22380		TIC	time for coffee (.1.2)		Lus10002447 [exp]	6.0	0.7555
AT4G03600			unknown protein		Lus10018599 [exp]	6.9	0.8168
AT5G25752		ATRBL11	ARABIDOPSIS RHOMBOID-LIKE PROT...		Lus10022131 [exp]	10.8	0.7442
AT1G18010			Major facilitator superfamily ...		Lus10043371 [exp]	13.8	0.7924
AT1G57680			unknown protein		Lus10008842 [exp]	15.6	0.7716
					Lus10022802 [exp]	16.2	0.8150
AT3G01270			Pectate lyase family protein (...		Lus10023623 [exp]	17.0	0.7709
AT4G16530			Family of unknown function (DU...		Lus10000730 [exp]	18.5	0.7773

Compare expression of checked genes

Lus10035454 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.