Plant FIBer expression Database

Lus10035455 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57450 69 / 4e-17 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031071
[exp]
122 / 1e-38 AT3G57450 69 / 5e-17 unknown protein
Lus10018070
[exp]
74 / 3e-19 AT3G57450 66 / 1e-15 unknown protein
Lus10042063
[exp]
72 / 6e-18 AT3G57450 67 / 1e-15 unknown protein
Lus10029496
[exp]
64 / 3e-15 AT3G57450 64 / 6e-15 unknown protein
Lus10019730
[exp]
63 / 6e-15 AT3G57450 66 / 8e-16 unknown protein
Lus10016391
[exp]
63 / 7e-15 AT3G57450 66 / 1e-15 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G055901
[exp]
78 / 8e-21 AT3G57450 70 / 2e-17 unknown protein
Potri.001G263404
[exp]
68 / 6e-17 AT3G57450 64 / 3e-15 unknown protein
Potri.006G050800
[exp]
67 / 1e-16 AT3G57450 59 / 4e-13 unknown protein
Potri.012G032500
[exp]
60 / 1e-13 AT3G57450 66 / 2e-15 unknown protein
Potri.009G058500
[exp]
57 / 2e-12 AT3G57450 47 / 1e-08 unknown protein
PFAM info
Representative CDS sequence
>Lus10035455 pacid=23170601 polypeptide=Lus10035455 locus=Lus10035455.g ID=Lus10035455.BGIv1.0 annot-version=v1.0
ATGGGGAAGTACATGGAGCTGTTGGACGCAAGCGTGAGGATCGCCGGAAGATTCTACTCCCACTGCCCGCAGACTGCTAGGCTCTACTACCATCCACCTT
CAAATAATTCCGACCAGCTCCACCATCTCGCCAACGGCGGCGGTTGCTGCAAGAGTACTGCCCAGAGAGATGAACCATCTCGCCAACGGCGGGGGTGGGA
CAAAACAAAAGCAAGTTGA
AA sequence
>Lus10035455 pacid=23170601 polypeptide=Lus10035455 locus=Lus10035455.g ID=Lus10035455.BGIv1.0 annot-version=v1.0
MGKYMELLDASVRIAGRFYSHCPQTARLYYHPPSNNSDQLHHLANGGGCCKSTAQRDEPSRQRRGWDKTKAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57450 unknown protein Lus10035455
[exp]
0 1
AT5G54490 PBP1 pinoid-binding protein 1 (.1) Lus10036734
[exp]
1.4 0.9169
AT3G57450 unknown protein Lus10031071
[exp]
1.7 0.9217
AT4G27280 Calcium-binding EF-hand family... Lus10033753
[exp]
11.0 0.8922
AT4G33920 Protein phosphatase 2C family ... Lus10002110
[exp]
12.2 0.8893
AT1G06450 Polynucleotidyl transferase, r... Lus10035078
[exp]
12.7 0.8993
AT3G07200 RING/U-box superfamily protein... Lus10022569
[exp]
13.4 0.8850
AT2G01300 unknown protein Lus10004069
[exp]
16.0 0.7782
AT5G39670 Calcium-binding EF-hand family... Lus10042369
[exp]
17.3 0.8693
AT1G64700 unknown protein Lus10008274
[exp]
18.1 0.8798
AT4G17230 GRAS SCL13 SCARECROW-like 13 (.1) Lus10017554
[exp]
20.0 0.8795

Lus10035455 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.