Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14040 100 / 3e-26 EXS (ERD1/XPR1/SYG1) family protein (.1) AT2G03260 99 / 2e-25 EXS (ERD1/XPR1/SYG1) family protein (.1) AT2G03240 96 / 2e-24 EXS (ERD1/XPR1/SYG1) family protein (.1) AT2G03250 80 / 7e-19 EXS (ERD1/XPR1/SYG1) family protein (.1) AT1G26730 72 / 3e-16 EXS (ERD1/XPR1/SYG1) family protein (.1) AT3G29060 72 / 4e-16 EXS (ERD1/XPR1/SYG1) family protein (.1) AT1G35350 68 / 9e-15 EXS (ERD1/XPR1/SYG1) family protein (.1) AT4G25350 67 / 2e-14 SHB1 SHORT HYPOCOTYL UNDER BLUE1, EXS (ERD1/XPR1/SYG1) family protein (.1) AT1G69480 59 / 2e-11 EXS (ERD1/XPR1/SYG1) family protein (.1) AT1G68740 44 / 4e-06 PHO1;H1 EXS (ERD1/XPR1/SYG1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031081 [exp] 126 / 1e-37 AT1G14040 191 / 9e-56 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10036782 [exp] 123 / 3e-35 AT1G14040 322 / 4e-103 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10036779 [exp] 125 / 9e-35 AT1G14040 1080 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10037147 [exp] 122 / 9e-34 AT1G14040 1071 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10037146 [exp] 118 / 1e-33 AT4G25350 369 / 2e-121 SHORT HYPOCOTYL UNDER BLUE1, EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10030440 [exp] 119 / 9e-33 AT1G14040 1048 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10030438 [exp] 112 / 3e-30 AT1G14040 976 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10030439 [exp] 111 / 5e-30 AT1G14040 1127 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10026623 [exp] 110 / 1e-29 AT1G14040 1058 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G090400 [exp] 101 / 1e-26 AT1G14040 1037 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.010G165800 [exp] 101 / 2e-26 AT1G14040 1032 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.010G165300 [exp] 100 / 5e-26 AT1G14040 1022 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.010G164900 [exp] 96 / 1e-24 AT1G14040 992 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.017G086800 [exp] 87 / 3e-21 AT3G29060 853 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.010G165400 [exp] 72 / 6e-17 AT1G69480 115 / 2e-29 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.016G032900 [exp] 73 / 2e-16 AT1G14040 865 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.008G090300 [exp] 72 / 3e-16 AT1G69480 831 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.010G165001 [exp] 45 / 2e-07 AT1G69480 87 / 6e-21 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.008G110800 [exp] 44 / 3e-06 AT1G68740 1096 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03105 [flax] [poplar] SPX SPX domain
Representative CDS sequence Show only first row Show all	>Lus10035467 pacid=23170641 polypeptide=Lus10035467 locus=Lus10035467.g ID=Lus10035467.BGIv1.0 annot-version=v1.0 ATGGCCTCAGATGAAGGCGGAGAGTTTGAGCTTGTTTACTTCAGGAAGCTAGATGATGAGCTCAATAAAGTGAACAACTTCTACAAGTCCAAGGTTGGTG AGGTTTTGAAAGAAGCTGATACTTTGAAAAAGCATATGGATGCTCTGATTGCGTTTAGGATCAAGGTTGAGAACCCCATCGGTTGGTCTCGTTGCGATAG GGAAGAACTGATCACGCGGCTGGCTTCTGATGTTGCAGCTTCTGCTGCTGCATTGGATGCTTCTACCCCTTCTTGA
AA sequence Show only first row Show all	>Lus10035467 pacid=23170641 polypeptide=Lus10035467 locus=Lus10035467.g ID=Lus10035467.BGIv1.0 annot-version=v1.0 MASDEGGEFELVYFRKLDDELNKVNNFYKSKVGEVLKEADTLKKHMDALIAFRIKVENPIGWSRCDREELITRLASDVAASAAALDASTPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10035467 [exp]	0	1
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10042095 [exp]	3.0	0.9330
AT1G17930			Aminotransferase-like, plant m...		Lus10027047 [exp]	4.0	0.9351
AT3G09870			SAUR-like auxin-responsive pro...		Lus10030263 [exp]	4.4	0.9423
AT4G17810	C2H2ZnF	ZFP12	C2H2 and C2HC zinc fingers sup...		Lus10040083 [exp]	6.9	0.9308
AT5G19875			unknown protein		Lus10006311 [exp]	7.4	0.9094
AT5G48905		LCR12	low-molecular-weight cysteine-...		Lus10021078 [exp]	9.2	0.8844
AT1G60060			Serine/threonine-protein kinas...		Lus10024800 [exp]	9.5	0.9227
AT2G24800			Peroxidase superfamily protein...		Lus10020097 [exp]	9.9	0.9048
AT1G13570			F-box/RNI-like superfamily pro...		Lus10011048 [exp]	12.5	0.9181
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10029575 [exp]	12.7	0.9176

Compare expression of checked genes

Lus10035467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.