Lus10035468 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031082 234 / 7e-76 ND /
Lus10020249 73 / 1e-15 ND /
Lus10024934 66 / 4e-13 ND /
Lus10025503 64 / 3e-12 ND /
Lus10002735 44 / 1e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10035468 pacid=23170541 polypeptide=Lus10035468 locus=Lus10035468.g ID=Lus10035468.BGIv1.0 annot-version=v1.0
ATGGCCACTACCGTGGTCATTAACAATACCACAAAACCTAAGACGAAAGTGTTGAAGTTAACATTCGATGATACGAGGAATAGCACTTGGAAGAACTGCT
CTTCGTTGAAACTAGCGGGCAGCCCCAAGTTGAGGATTGAGTCGGACGTTGTCCACATCGGGGACTCAGAGATCAAGGTGTCAGCTAGCGAGTATGGGAC
TTCATATGTGTGGGATGAAACAACAATGAGGACATTGAGCGTGACAAGAGTACATAAGGTTGTGGTGTCACCAATGATGAAGATTACAGTAAGACTTGTT
GTGATGATCGGTATGTGTGAAGTTCCATTCTCATACGTTCAACACGACATTCTTTACAACAGAGAAGATGAAACTTATGTTCAAGATGATGGGTTGTATG
TAGGAACCAACGCTTATAACTTTGTCTATGAGACATCGGAAGATCCACTAGAGGCTAGACTCTAG
AA sequence
>Lus10035468 pacid=23170541 polypeptide=Lus10035468 locus=Lus10035468.g ID=Lus10035468.BGIv1.0 annot-version=v1.0
MATTVVINNTTKPKTKVLKLTFDDTRNSTWKNCSSLKLAGSPKLRIESDVVHIGDSEIKVSASEYGTSYVWDETTMRTLSVTRVHKVVVSPMMKITVRLV
VMIGMCEVPFSYVQHDILYNREDETYVQDDGLYVGTNAYNFVYETSEDPLEARL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10035468 0 1
AT1G11000 ATMLO4, MLO4 MILDEW RESISTANCE LOCUS O 4, S... Lus10001292 1.0 0.7949
AT1G80245 Spc97 / Spc98 family of spindl... Lus10018344 3.6 0.6924
AT2G26975 Ctr copper transporter family ... Lus10023045 4.2 0.7660
AT1G24590 AP2_ERF ESR2, DRNL, SOB... FOR SUPPRESSOR OF PHYTOCHROMEB... Lus10017907 6.0 0.7592
AT1G13290 C2H2ZnF WIP6, DOT5 WIP domain protein 6, DEFECTIV... Lus10035044 6.5 0.7170
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10002511 11.8 0.7526
AT1G52190 Major facilitator superfamily ... Lus10008539 17.1 0.7251
AT1G65450 HXXXD-type acyl-transferase fa... Lus10029920 22.1 0.7079
AT5G43190 Galactose oxidase/kelch repeat... Lus10007740 22.5 0.7383
AT5G11730 Core-2/I-branching beta-1,6-N-... Lus10034348 23.4 0.7079

Lus10035468 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.