Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38960 229 / 3e-77 CO B-box type zinc finger family protein (.1.2.3) AT2G21320 218 / 8e-73 CO B-box zinc finger family protein (.1) AT1G78600 105 / 2e-27 CO BBX22, DBB3, STH3, LZF1 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) AT1G06040 93 / 6e-24 CO BBX24, STO SALT TOLERANCE, B-box domain protein 24, B-box zinc finger family protein (.1.2) AT1G75540 95 / 2e-23 CO LHUS, AtBBX21, STH2 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) AT2G31380 93 / 3e-23 CO STH salt tolerance homologue (.1) AT4G39070 90 / 5e-22 CO B-box zinc finger family protein (.1) AT2G24790 85 / 6e-20 CO COL3, ATCOL3 CONSTANS-like 3 (.1.2) AT5G24930 84 / 5e-19 CO COL4, ATCOL4 CONSTANS-like 4 (.1) AT5G15850 83 / 7e-19 CO COL1, ATCOL1 CONSTANS-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031087 [exp] 360 / 8e-129 AT4G38960 229 / 5e-77 B-box type zinc finger family protein (.1.2.3) Lus10018076 [exp] 246 / 5e-84 AT4G38960 215 / 6e-72 B-box type zinc finger family protein (.1.2.3) Lus10042069 [exp] 131 / 4e-39 AT4G38960 112 / 5e-32 B-box type zinc finger family protein (.1.2.3) Lus10042498 [exp] 101 / 7e-26 AT1G78600 274 / 1e-91 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Lus10038147 [exp] 100 / 1e-25 AT1G78600 281 / 2e-94 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Lus10028791 [exp] 95 / 5e-24 AT1G75540 206 / 9e-66 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Lus10017495 [exp] 93 / 3e-23 AT1G75540 202 / 2e-64 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Lus10027041 [exp] 87 / 9e-21 AT1G06040 298 / 1e-102 SALT TOLERANCE, B-box domain protein 24, B-box zinc finger family protein (.1.2) Lus10025579 [exp] 87 / 1e-20 AT1G06040 297 / 2e-102 SALT TOLERANCE, B-box domain protein 24, B-box zinc finger family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G124400 [exp] 283 / 4e-98 AT4G38960 251 / 8e-86 B-box type zinc finger family protein (.1.2.3) Potri.004G162600 [exp] 274 / 1e-94 AT4G38960 248 / 1e-84 B-box type zinc finger family protein (.1.2.3) Potri.007G015200 [exp] 239 / 2e-81 AT4G38960 197 / 5e-65 B-box type zinc finger family protein (.1.2.3) Potri.005G117100 [exp] 235 / 2e-79 AT2G21320 192 / 4e-63 B-box zinc finger family protein (.1) Potri.001G384000 [exp] 105 / 1e-27 AT1G78600 284 / 1e-95 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Potri.011G105400 [exp] 99 / 3e-25 AT1G78600 284 / 1e-95 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Potri.004G161000 [exp] 97 / 5e-25 AT4G39070 192 / 6e-62 B-box zinc finger family protein (.1) Potri.002G028200 [exp] 96 / 5e-24 AT1G75540 252 / 2e-82 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Potri.005G234500 [exp] 96 / 6e-24 AT1G75540 185 / 2e-56 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Potri.009G122000 [exp] 90 / 3e-22 AT4G39070 202 / 1e-65 B-box zinc finger family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00643 [flax] [poplar] zf-B_box B-box zinc finger
Representative CDS sequence Show only first row Show all	>Lus10035472 pacid=23170610 polypeptide=Lus10035472 locus=Lus10035472.g ID=Lus10035472.BGIv1.0 annot-version=v1.0 ATGCGAACTCTTTGCGATGTTTGCGAAAGCGCCGCCGCCATCCTCTTCTGCGCCGCCGACGAAGCCGCGCTCTGCCGCGCCTGCGATGAGAAGGTTCATT TGTGTAACAAGCTAGCTAGCAGACATGTACGAGTTGGTCTGGCTGATCCCAGTGCAGTCCCTCGTTGTGACATATGCGAAAATGCGCCTGCTTTCTTTTA TTGTGAGGTTGATGGTACTTCGCTCTGCCTGCAATGCGATATGGTTGTGCATGTTGGTGGCAAAAGAACCCATGGGAGATATCTTTTATTGAGGCAGAGG GTGGAGTTTCCAGGCGACAAACCTGGCCAAGTGGAGGATCAAAATGGTACCAGGAGGGACCAAAGGCAGCAACCTGATAATGCAAAGAGAGAAAATCAGC AAGATCATAGTGTTCCACCGATTCTGGCTACAGAGAACCATTCAGGAGCTGCGAATGGAGTAGCTGAAAATAATTTGATAGACCTTAATTCCCGGCCTCA GCGGATACAGGGTGAAGATTCAAATAACCAGCAAGATGACCACTGCAGCAGATGCTCGGTTTCGAAGACTCCAATTGCTGGAAGCTAA
AA sequence Show only first row Show all	>Lus10035472 pacid=23170610 polypeptide=Lus10035472 locus=Lus10035472.g ID=Lus10035472.BGIv1.0 annot-version=v1.0 MRTLCDVCESAAAILFCAADEAALCRACDEKVHLCNKLASRHVRVGLADPSAVPRCDICENAPAFFYCEVDGTSLCLQCDMVVHVGGKRTHGRYLLLRQR VEFPGDKPGQVEDQNGTRRDQRQQPDNAKRENQQDHSVPPILATENHSGAANGVAENNLIDLNSRPQRIQGEDSNNQQDDHCSRCSVSKTPIAGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38960	CO		B-box type zinc finger family ...		Lus10035472 [exp]	0	1
AT3G10113	MYB		Homeodomain-like superfamily p...		Lus10031893 [exp]	2.8	0.8766
AT1G21890			nodulin MtN21 /EamA-like trans...		Lus10021201 [exp]	3.6	0.8987
AT3G14280			unknown protein		Lus10003937 [exp]	4.0	0.8875
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10000354 [exp]	6.5	0.8541
AT1G18530			EF hand calcium-binding protei...		Lus10039961 [exp]	7.1	0.8306
AT3G54500			unknown protein		Lus10039553 [exp]	9.6	0.7912
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10012039 [exp]	11.7	0.8493
AT1G29010			unknown protein		Lus10015398 [exp]	14.9	0.7868
AT5G18670		BAM9, BMY3	BETA-AMYLASE 9, beta-amylase 3...		Lus10012804 [exp]	15.3	0.8733
AT3G47090			Leucine-rich repeat protein ki...		Lus10003071 [exp]	16.6	0.8246

Compare expression of checked genes

Lus10035472 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.