Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75560 47 / 7e-08 zinc knuckle (CCHC-type) family protein (.1), zinc knuckle (CCHC-type) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031093 [exp] 88 / 3e-23 AT1G75560 49 / 8e-07 zinc knuckle (CCHC-type) family protein (.1), zinc knuckle (CCHC-type) family protein (.2) Lus10041902 [exp] 44 / 1e-06 AT4G36020 159 / 2e-47 cold shock domain protein 1 (.1) Lus10028449 [exp] 42 / 6e-06 AT4G36020 158 / 3e-47 cold shock domain protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G161800 [exp] 89 / 8e-24 AT1G75560 273 / 2e-92 zinc knuckle (CCHC-type) family protein (.1), zinc knuckle (CCHC-type) family protein (.2) Potri.005G234700 [exp] 77 / 4e-19 AT1G75560 278 / 2e-94 zinc knuckle (CCHC-type) family protein (.1), zinc knuckle (CCHC-type) family protein (.2) Potri.007G057100 [exp] 42 / 4e-06 AT4G36020 127 / 3e-35 cold shock domain protein 1 (.1) Potri.005G112800 [exp] 41 / 8e-06 AT2G17870 86 / 1e-19 ARABIDOPSIS COLD SHOCK DOMAIN PROTEIN 3, cold shock domain protein 3 (.1) Potri.006G109250 [exp] 39 / 3e-05 AT1G21280 52 / 6e-08 unknown protein Potri.004G133001 [exp] 39 / 6e-05 AT1G21280 46 / 6e-06 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0511 [flax] [poplar] Retroviral_zf PF00098 [flax] [poplar] zf-CCHC Zinc knuckle
Representative CDS sequence Show only first row Show all	>Lus10035477 pacid=23170567 polypeptide=Lus10035477 locus=Lus10035477.g ID=Lus10035477.BGIv1.0 annot-version=v1.0 ATGAGAGGGAGCAGTTACCAGGACGTAGTATGCAGGAGCTGCCACCAGTATGGACACATGAGTAGGGACTGCATGGGTGGTGCGTTAATGATCTGCCACA ACTGCGGTGGTCGTGGACATCGCGCCGTCGAGTGTCCTTCCAGTAGGATGATGGAGCGATATCCGCCGCGTAGGTACTACTGA
AA sequence Show only first row Show all	>Lus10035477 pacid=23170567 polypeptide=Lus10035477 locus=Lus10035477.g ID=Lus10035477.BGIv1.0 annot-version=v1.0 MRGSSYQDVVCRSCHQYGHMSRDCMGGALMICHNCGGRGHRAVECPSSRMMERYPPRRYY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75560			zinc knuckle (CCHC-type) famil...		Lus10035477 [exp]	0	1
AT1G11320			unknown protein		Lus10017280 [exp]	3.2	0.9483
AT2G25970			KH domain-containing protein (...		Lus10004446 [exp]	5.0	0.9304
					Lus10027730 [exp]	10.4	0.9291
AT4G18360			Aldolase-type TIM barrel famil...		Lus10023302 [exp]	11.3	0.9386
AT1G75560			zinc knuckle (CCHC-type) famil...		Lus10035476 [exp]	13.9	0.8737
AT4G25030			unknown protein		Lus10036514 [exp]	14.1	0.9310
AT1G07160			Protein phosphatase 2C family ...		Lus10041072 [exp]	18.0	0.9332
AT3G52870			IQ calmodulin-binding motif fa...		Lus10035595 [exp]	21.2	0.9284
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10006742 [exp]	22.0	0.9279
AT5G60410		ATSIZ1, SIZ1	DNA-binding protein with MIZ/S...		Lus10023344 [exp]	25.9	0.9252

Compare expression of checked genes

Lus10035477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.