Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09060 37 / 0.0006 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027784 [exp] 64 / 3e-14 ND 63 / 3e-05 Lus10030513 [exp] 62 / 2e-12 AT3G09060 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G111600 [exp] 41 / 3e-05 AT3G09060 860 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035514 pacid=23147463 polypeptide=Lus10035514 locus=Lus10035514.g ID=Lus10035514.BGIv1.0 annot-version=v1.0 ATGAGGCCCAGCAGGCCAAGGCTTGGATCAGCAAAGGAGAAGGCCCAACAAATTCAAGAAGGCCGTATGTTCTGGGTATGTAGGGGTGCAAGGTATTGGC CCGTTGGCCAGCTTAGTTTTTTTATAGTCGACGATCTACGCACCTTCCTACGAATGGAGGAGTTTTTCCAGTGCAAGCCGGGGGTTAGCCCTTGCGAAGC AATGCGCTGGGGATTTGTTGAGAAGGAGCAATGGAAGAAGGCTGAGGAATTTCTGGCATCTTGTAACGGTGGGTGCAGCGCCTAA
AA sequence Show only first row Show all	>Lus10035514 pacid=23147463 polypeptide=Lus10035514 locus=Lus10035514.g ID=Lus10035514.BGIv1.0 annot-version=v1.0 MRPSRPRLGSAKEKAQQIQEGRMFWVCRGARYWPVGQLSFFIVDDLRTFLRMEEFFQCKPGVSPCEAMRWGFVEKEQWKKAEEFLASCNGGCSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035514 [exp]	0	1
					Lus10025813 [exp]	21.9	0.6669
AT2G04480			unknown protein		Lus10001750 [exp]	25.0	0.6725
					Lus10007590 [exp]	29.8	0.6442
AT1G24340		EMB260, EMB2421	EMBRYO DEFECTIVE 260, EMBRYO D...		Lus10006431 [exp]	42.2	0.5386
AT3G23600			alpha/beta-Hydrolases superfam...		Lus10000665 [exp]	49.5	0.6204
AT5G27740		RFC3, EMB251, E...	replication factor C 3, EMBRYO...		Lus10041764 [exp]	59.0	0.6391
AT4G04980			unknown protein		Lus10036173 [exp]	67.5	0.6232
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Lus10001465 [exp]	72.9	0.6021
AT3G23600			alpha/beta-Hydrolases superfam...		Lus10000668 [exp]	83.6	0.5637
AT4G18425			Protein of unknown function (D...		Lus10013970 [exp]	85.6	0.5837

Compare expression of checked genes

Lus10035514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.