Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027765 [exp] 151 / 2e-43 AT5G48385 79 / 6e-15 FRIGIDA-like protein (.1) Lus10027766 [exp] 129 / 8e-36 AT5G01270 820 / 0.0 carboxyl-terminal domain (ctd) phosphatase-like 2 (.1), carboxyl-terminal domain (ctd) phosphatase-like 2 (.2) Lus10027773 [exp] 117 / 2e-31 ND 56 / 7e-08 Lus10035529 [exp] 71 / 7e-16 ND 39 / 0.001 Lus10003566 [exp] 46 / 1e-06 ND / Lus10033831 [exp] 46 / 1e-06 AT5G27220 153 / 2e-37 Frigida-like protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10035523 pacid=23147489 polypeptide=Lus10035523 locus=Lus10035523.g ID=Lus10035523.BGIv1.0 annot-version=v1.0 ATGAAGGAAACTGAATTCTCTGGTATCAAATCTTCCATTGAGGAATGCCTCAAGGATTTGGATATGAAGAAGGAAGAACTCGATGCAACCAGAAACTTGT CTGAGAAGCAACACAAAGAGATTTATTTGAACCAGGTTCATCTTGATTCTGTTTGTGAGTTGGTTAAGGAATATGATGAAGAACTTGAATCGAAGAAAAA GGAGCTGGATTTTGTTGAAGAAAAACATCAAGCATCTGTTAAGAATCTTGAATTGAAAGAGACCGCGCTAAGTAGTATTGAAACATCCATCAAAGGTCGA CACGAAGTGCTTGAATCAATGAAGGAGCAGACAATTTCCATACAGACATTGATTGAATAA
AA sequence Show only first row Show all	>Lus10035523 pacid=23147489 polypeptide=Lus10035523 locus=Lus10035523.g ID=Lus10035523.BGIv1.0 annot-version=v1.0 MKETEFSGIKSSIEECLKDLDMKKEELDATRNLSEKQHKEIYLNQVHLDSVCELVKEYDEELESKKKELDFVEEKHQASVKNLELKETALSSIETSIKGR HEVLESMKEQTISIQTLIE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10035523 [exp]	0	1
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10011633 [exp]	1.4	0.9617
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10003530 [exp]	2.0	0.9590
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	11.7	0.9347
AT5G67090			Subtilisin-like serine endopep...		Lus10009365 [exp]	11.8	0.9271
					Lus10015828 [exp]	13.6	0.9330
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002933 [exp]	13.9	0.9292
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	15.3	0.9307
AT1G24540		CYP86C1	"cytochrome P450, family 86, s...		Lus10006232 [exp]	15.4	0.9197
AT1G49490			Leucine-rich repeat (LRR) fami...		Lus10027935 [exp]	18.3	0.9261
AT2G03200			Eukaryotic aspartyl protease f...		Lus10022917 [exp]	21.7	0.9250

Compare expression of checked genes

Lus10035523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.